KEGG   Paracoccus sp. BM15: CUV01_12105Help
Entry
CUV01_12105       CDS       T05237                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
paro  Paracoccus sp. BM15
Pathway
paro00230  Purine metabolism
paro00240  Pyrimidine metabolism
paro01100  Metabolic pathways
paro01110  Biosynthesis of secondary metabolites
paro01130  Biosynthesis of antibiotics
Module
paro_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
paro_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
paro_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:paro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CUV01_12105
   00240 Pyrimidine metabolism
    CUV01_12105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:paro04131]
    CUV01_12105
Enzymes [BR:paro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CUV01_12105
Membrane trafficking [BR:paro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CUV01_12105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AUH35405
UniProt: A0A2K9EUD7
Position
2480475..2480897
Genome map
AA seq 140 aa AA seqDB search
MATERTLSIIKPDATTRNLTGKINAKFEDAGLRIVAQKRIHLTPAQAGQFYIVHKDRPFF
GELTEFMASAPVVVQVLEGEGAIAKNREVMGATNPADAAPGTIRKEFAESVGENSVHGSD
APETAAEEIAFFFSGLELVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgaacgcacgctttccatcatcaaacccgatgcgaccacccgcaacctgacc
ggcaagatcaacgccaagttcgaggatgccggcctgcgcatcgtcgcccaaaagcgcatc
cacctgaccccggcacaggcgggtcagttctatatcgtccacaaggatcgccccttcttt
ggcgaactgaccgaattcatggcctcggccccggtcgtcgtgcaggtgctggaaggcgaa
ggcgccattgccaagaaccgcgaagtgatgggcgcaaccaaccccgccgacgcagccccc
ggcaccatccgcaaggaattcgcggaatcggtcggtgagaactcggtccacggctcggac
gccccggaaaccgcagcggaagaaatcgcctttttcttcagcggcctggaactggtcggc
taa

DBGET integrated database retrieval system