KEGG   Paracoccus sp. Arc7-R13: EOJ32_01450Help
Entry
EOJ32_01450       CDS       T06050                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
parr  Paracoccus sp. Arc7-R13
Brite
KEGG Orthology (KO) [BR:parr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EOJ32_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AZY92474
UniProt: A0A3Q9TGD0
Position
complement(293051..294481)
Genome map
AA seq 476 aa AA seqDB search
MTHRPGFRALDKDLGRIGHAEVAQMHAFRPVWRLGLAVLALVGGLLMVMALSGAAPGMLA
IGAGLVVAAWLGVAIGANDVANSLGPAVGAGAIGLLPGLALVAVAGVAGAVLAGGAVSAR
LAGGIVQLAPLAEGGRAPMMMVAALIGAAVWITLATGIGLPVSTSHSIVGGIAGAGAVAL
GLSAVAWGTLAIIASVWMVTPVVAGGLAGGLLILLRLKVVEAPDRAGAALLWLPLLVGLM
AALFSAYVVVLLDLGPLAACAAAAPTGAGALWLTRRSVLRELARHPRKPSTKSLLRPALV
MSVLILGFAHGANDVGNIAGPLSVVLRGQGMSTAIGVVPVLVLAGGGLAIATGTLLFGRR
LVHMVGSGITKLNAGRAFCVSLATAVTVLGASALGLPVSTTHVAVGGIFGVGFAREWLDR
RRGSRSEALPADETRRRILVRRSHVVTITAAWLVTLPITASLGALACLLVLWVTGV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaccgccccggctttcgcgcgctggacaaggatctgggccgcatcggccatgcc
gaggtcgcgcagatgcatgccttccgccccgtctggcggctggggctggcggtgctggcg
ctggtgggcgggttgctgatggtcatggcgctgtcgggtgccgcgcccggcatgctggcc
atcggggcggggctggtggtcgcggcctggctgggcgtggcgatcggggcgaacgacgtc
gcgaattccttgggtccggcggtcggggcgggggccatcggactgctgcccgggctggcg
ctggtcgccgtcgcgggcgtggcgggggcggtgctggccgggggcgcggtgtcggcccgt
ctggcgggcggcatcgtccagctggcacccctggccgagggcgggcgcgccccgatgatg
atggtcgccgcgctgatcggggcggcagtctggatcaccctggccacgggcatcggcctg
ccggtcagcacgtcgcattccatcgtgggtggcatcgcgggggcgggggcggtggccctg
ggcctgtcggcggtggcctgggggacgctggccatcatcgcatctgtctggatggtgacg
ccggtggtggcggggggcttggccggcggtctgctgatcctgctgcgccttaaggtggtc
gaggcgccggaccgcgccggggcggcgcttttgtggctgccgctgctggtcggcctgatg
gcggcgctgttttcggcctatgtcgtggtgctgctggacctgggaccactggccgcctgt
gcggcggccgcgccgaccggggcgggcgcgctgtggctgacgcggcgcagcgtgctccgc
gaactggcacgccatccgcgtaaaccaagcacaaagtctctgctgcgccccgcgctggtg
atgtccgtgctgatcctgggctttgcccatggcgccaatgacgtgggcaacatcgcggga
ccgctgtcggtggtcctgcgcggacaggggatgtcgaccgcgatcggcgtggtcccggtg
ctggtgctggcgggcggagggcttgccatcgccaccggcacgctgctgttcgggcgccgc
ctggtccacatggtgggcagcggcatcaccaagctgaacgcggggcgcgccttctgcgtg
tcgctggccacggccgtgacggtgctgggcgcatcggccctgggcctgccggtgtcgacc
acccatgtggcggtcggcggcatcttcggcgtgggttttgcgcgcgaatggctggaccgc
cgccgcggcagccggtccgaggccctgcccgcggacgagacgcgccgccgcatcctggtg
cggcgcagccatgtcgtgaccatcaccgccgcctggctggtgacactgccgatcacggca
tcgcttggggcgctggcctgtctgctggtgctgtgggtgaccggagtctag

DBGET integrated database retrieval system