KEGG   Paracoccus sp. Arc7-R13: EOJ32_06605Help
Entry
EOJ32_06605       CDS       T06050                                 

Definition
(GenBank) aminotransferase
  KO
K21909  D-erythrulose 1-phosphate 3-epimerase [EC:5.1.3.38]
Organism
parr  Paracoccus sp. Arc7-R13
Brite
KEGG Orthology (KO) [BR:parr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EOJ32_06605
Enzymes [BR:parr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.38  D-erythrulose 1-phosphate 3-epimerase
     EOJ32_06605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AZY93390
UniProt: A0A3T0Q0H0
Position
1310753..1311685
Genome map
AA seq 310 aa AA seqDB search
MMLTLSLNTNPLVNRFADPDDLIDTVARDLRIRDLQLTHEFINPSWPAPVIRRLTRQMRA
ALDRTGVRVTSGMTGPYGRLNHFGHPDADVRRYYVDWFKTFADITADLGGRSVGTQFAIF
TYRDYDGPARREDLIRIAIDCWAEVADHAKAAGLDYVFWEPMSVGREFGETIPAALALQD
RLSAADMAVPMWMMADIDHGDVTSPDPDDLDPYAWARAVPRVSPIIHIKQSLMDKGGHRP
FTAEFNAKGRVQPEPLLEALAQGGAVDNEICLELSFKERDPNDRQVIAQIAESVAFWAPH
IDTGADKLNI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgatgctgaccctgtcgctgaacaccaacccgctggtcaaccgctttgccgatccggac
gacctgatcgacacggtcgcgcgcgatctgcgcatccgcgacctgcagttgacgcatgag
ttcatcaatccctcctggcccgcgccggtgatccgccgcctgacccggcagatgcgcgcg
gcgctggaccggaccggggtgcgcgtcaccagcggcatgacaggcccctatggtcggctg
aaccatttcggccatcccgatgcggatgtgcggcgatactatgtcgactggttcaagacc
ttcgcggacatcaccgccgatctgggcggtcgatcggtgggcacgcaattcgcgatcttc
acctatcgcgattacgacggtccggcccggcgcgaggacctgatccgcatcgccatcgac
tgctgggccgaggtcgcggatcacgcgaaggccgccgggctggactatgtcttctgggag
cccatgagcgtgggccgcgaattcggagagacgatcccggccgccctggcgctgcaggac
cggctgagcgcggccgacatggcggtgccgatgtggatgatggccgatatcgaccacggc
gacgtcaccagccccgatccggacgatctggacccctatgcctgggcccgcgccgtgccg
cgcgtcagcccgatcatccacatcaagcagtcgctgatggacaagggcggccaccgcccc
ttcaccgccgaattcaacgccaagggccgcgtccagccggaacccctgctggaggcgctg
gcccagggcggcgcggtcgacaacgagatctgcctggagctgtccttcaaggaacgcgac
ccgaacgaccggcaggtcatcgcccagatcgccgaaagtgtcgcattctgggcgccgcat
atcgacaccggggcggataagctgaatatctga

DBGET integrated database retrieval system