KEGG   Paracoccus sp. Arc7-R13: EOJ32_10940Help
Entry
EOJ32_10940       CDS       T06050                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
parr  Paracoccus sp. Arc7-R13
Pathway
parr00471  D-Glutamine and D-glutamate metabolism
parr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:parr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EOJ32_10940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:parr01011]
    EOJ32_10940
Enzymes [BR:parr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     EOJ32_10940
Peptidoglycan biosynthesis and degradation proteins [BR:parr01011]
 Precursor biosynthesis
  Racemase
   EOJ32_10940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race FCD
Motif
Other DBs
NCBI-ProteinID: AZY94128
UniProt: A0A3Q9TF82
Position
complement(2189816..2190628)
Genome map
AA seq 270 aa AA seqDB search
MAIGVFDSGLGGLTVHQAIAARLPDLPLVYLGDNAHAPYGVRTADDIFDLTCKGVERLWD
EGCDLVILACNTASAAALKRMQETWLPADKRVLGVFVPMIEALTERAWGDNSPPRRVAVN
NVALFATPATVASRAFQRELAFRAVGVDVEAQPCAGVVDAIEMGDEQLAEALVTSHVEAL
KRRMPYPEAAVLGCTHYPLMQDAFQRALGPQVKVFSQAGLVAESLADYLTRRPEFVGSGT
TSMYLTTGDPVRVGGKATQFLRRAISFDPA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcgattggggtgttcgattcgggtctgggcgggctgacggtccatcaggccattgcc
gcgcgcctgcctgacctgccgctggtctatctgggcgacaacgcccatgcgccctatggg
gtgcgcaccgccgacgacattttcgatctgacctgcaagggcgtcgagcgcctgtgggac
gagggctgcgatctggtaatcctggcctgcaacaccgccagtgccgctgcgctgaagcgg
atgcaggaaacctggctgccggcggacaagcgcgtcctgggcgtgttcgttcccatgatc
gaggcgctgaccgaacgggcctggggcgataattcgccgccgcgccgggtggcggtcaac
aacgtcgcgctgtttgccacacccgcgaccgtcgccagccgcgcgttccagcgcgaactg
gcgttccgcgcggtgggcgtcgatgtcgaggcccagccttgcgccggcgtggtcgatgcg
atcgagatgggcgacgagcagctggcggaggccctggtcaccagccatgtcgaggcgctg
aagcgccgcatgccgtacccggaggccgcggtgctgggctgcacccattacccgctgatg
caggacgcgttccagcgcgccctggggccgcaggtcaaggtcttcagccaggcggggctg
gtcgccgaaagcctggccgactatctgacgcgcaggcccgaattcgttgggtcgggcacg
acgtcgatgtatctgacgaccggcgatccggtgcgggtgggcggcaaggccacgcagttc
ctgcgccgcgccatcagctttgatcccgcctga

DBGET integrated database retrieval system