KEGG   Paracoccus sp. Arc7-R13: EOJ32_13345Help
Entry
EOJ32_13345       CDS       T06050                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
parr  Paracoccus sp. Arc7-R13
Brite
KEGG Orthology (KO) [BR:parr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EOJ32_13345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AZY94559
UniProt: A0A3T0Q3S3
Position
complement(2686255..2687739)
Genome map
AA seq 494 aa AA seqDB search
MAQNDLEARHLDTLDRDLGRFSALENATAYVARPLVAPGVALAFVLLAGLGAMVAFGQTD
NTLIVVVAAIFGAYMALNIGANDVANNMGPAVGANALTMGGAIAIAAVFETAGALIAGGD
VVSTISRGIIDPQTIGTDGIFVWAMMAALLSSALWVNLATWIGAPVSTTHSIVGGVMGAG
IAAAGFGAVNWPTMATIAASWVISPVLGGLIAAAFLWFIKARIIYRDDKIAAARVWVPVL
IGIMAGAFAAYLALKGLSRIVDVTFSGALMIGAVLGLVCWVVMIPVIRRQSRGLENRNKS
LKVLFGIPLVVSAALLSFAHGANDVANAVGPLAAIVQALGSGGTAEAVAIPLWVMLIGAF
GLSFGLFLFGPKLIRMVGSQITKLNPMRAYCVSLSAALTVILASWLGLPVSSTHIAVGAI
FGVGFFREWDAARRARAVQGQAPERPRTAPEERRRRKLVRRSHVLTIGAAWVVTVPAAAA
LSGALFWALRAIGG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaaacgacctggaagcccgacatctcgatacgctggaccgcgacctggggcgg
ttctcggcgctggaaaacgctaccgcctatgtcgcgcgcccgctggtcgcgccgggcgtc
gcgctggccttcgtgctgctggccgggctgggggcgatggtcgccttcggacagaccgac
aacacgctgatcgtcgtggtcgcggcgatcttcggcgcctacatggcgctgaacatcggc
gccaacgatgtggccaacaacatgggcccggcggtcggcgcgaatgcgctgaccatgggg
ggcgccatcgccatcgccgccgtgttcgagaccgcgggcgccctgatcgcgggcggcgac
gtggtcagcaccatctctcgcgggatcatcgatccgcagacgatcgggaccgacggcatc
ttcgtctgggcgatgatggcggcgctgctgtcatcggcgctgtgggtgaacctggcgacc
tggatcggcgcgccggtctccaccacccattccatcgtcggcggcgtgatgggcgcgggc
atcgccgcggccgggttcggcgcggtcaactggcccacgatggcgaccatcgcggccagc
tgggtgatctctccggtgctgggcgggctgatcgccgcggccttcctgtggttcatcaag
gcgcgcatcatctatcgcgacgacaagatcgcggccgcgcgcgtctgggtgccggtcctg
atcggcatcatggcgggtgcgttcgcggcctatctggcgctgaagggtcttagccgcatc
gtcgacgtgaccttctccggggcgctgatgatcggcgcggtgctgggcctggtctgctgg
gtcgtcatgatcccggtgatccgccgccagtcgcgcgggctggagaaccgcaacaagtcg
ctcaaggtgctgttcggcatcccgctggtcgtgtcggccgcgctgctgtcctttgcgcat
ggtgccaatgacgtggccaatgccgtcgggccgctggccgccatcgtgcaggccctggga
tcgggcggcacggcagaggccgtggccatcccgctttgggtgatgctgatcggggcgttc
ggcctgtccttcggtctgttcctgttcggacccaagctgatccgcatggtcggcagccag
atcaccaagctgaaccccatgcgtgcctattgcgtgtcgctgtcggcggcgctgacggtg
attttggccagctggctgggtctgccggtcagttcgacccacatcgccgtcggtgcgatc
ttcggggtgggcttttttcgcgaatgggacgcggcccgccgcgcccgcgccgtgcagggg
caggcccccgaacgcccccgcaccgcccccgaggagcgtcgccgccgcaagctggtgcgc
cggtcgcatgtgctgaccatcggcgcggcctgggtggtcacggttccggcggcggcggcc
ctgtcgggcgcgctgttctgggcgttgcgggcgatcggcggctag

DBGET integrated database retrieval system