KEGG   Paracoccus sp. Arc7-R13: EOJ32_15255Help
Entry
EOJ32_15255       CDS       T06050                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
parr  Paracoccus sp. Arc7-R13
Pathway
parr00020  Citrate cycle (TCA cycle)
parr00480  Glutathione metabolism
parr01100  Metabolic pathways
parr01110  Biosynthesis of secondary metabolites
parr01120  Microbial metabolism in diverse environments
parr01130  Biosynthesis of antibiotics
parr01200  Carbon metabolism
parr01210  2-Oxocarboxylic acid metabolism
parr01230  Biosynthesis of amino acids
Module
parr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
parr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:parr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EOJ32_15255
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EOJ32_15255
Enzymes [BR:parr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     EOJ32_15255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AZY94898
UniProt: A0A3Q9TEC0
Position
complement(3076953..3078164)
Genome map
AA seq 403 aa AA seqDB search
MSKIKVANPVVELDGDEMTRIIWDFIKQKLILPYLDIDLKYYDLGIEERDRTNDQITIDA
AEAIKRHGVGVKCATITPDEARAEEFGLKKMWRSPNGTIRNILGGVIFREPIICKNVPRL
VPGWTQPIIVGRHAFGDQYKATDFRFPGKGKLTIKFVGENGETIEHEVYDAPAAGVAMAM
YNLDDSIRDFARASLNYGLARGYPVYLSTKNTILKAYDGRFKDLFQEVYEAEFQDRFKKA
GIHYEHRLIDDMVASAMKWSGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGKI
VESEAAHGTVTRHYREHQKGNATSTNSIASIFAWTGGLKHRAKLDDNAALLTFAQTLEKV
TVQAVEDGHMTKDLALLVGPDQKWLTTMGYLEKVDQYLNKALN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagatcaaggttgccaatcccgtcgtcgagctggacggggacgagatgacgcgg
atcatctgggacttcatcaagcaaaagctgatcctgccctatctggacatcgacctgaaa
tattatgacctgggcatcgaggagcgcgaccgcaccaacgaccagatcaccatcgacgcg
gccgaggcgatcaagcgccacggggtcggcgtgaaatgcgcgaccatcacccccgacgag
gcgcgggccgaggaattcggcctgaagaagatgtggcgcagccccaatggcacgatccgc
aacatcctgggcggcgtgatcttccgcgaaccaatcatctgcaagaacgtgccgcggctg
gtgccgggctggacgcagccgatcatcgtcggccgccacgccttcggcgaccagtacaag
gccaccgatttccgttttccgggcaagggcaagctgaccatcaagttcgtcggcgagaac
ggcgagacgatcgagcacgaggtctatgacgcccccgccgccggggtcgcaatggccatg
tacaatctggacgattcgatccgcgatttcgcccgtgcctcgctgaactatggcctggcg
cgcggctatccggtctatctgtcaaccaagaacacgatcctcaaggcctatgacggccgc
ttcaaggacctgttccaggaggtctacgaggccgagttccaggaccggttcaagaaggcc
ggcatccattacgaacaccgcctgatcgacgacatggtcgcaagcgcgatgaaatggtcg
ggcggctatgtgtgggcctgcaagaactatgatggcgacgtgcagtcggacaccgtcgcg
cagggctttggcagccttggcctgatgacctcggtcctgatgaccccggacggcaagatc
gtcgaatccgaggccgcccatggcaccgtcacccgccactatcgcgaacaccagaagggc
aatgcgacctcgaccaactcgatcgcgtcgatctttgcctggaccggcggcctcaagcac
cgcgccaagctggacgacaacgccgccctgctgacctttgcgcagacgctggagaaggtg
accgtccaggcggtcgaggacggccacatgaccaaggacctggcgctgctggtgggtccc
gaccagaaatggctgaccacgatgggctatctggaaaaggtcgaccagtacctgaacaag
gcgctgaactga

DBGET integrated database retrieval system