KEGG   Paracoccus sp. SC2-6: DRW48_01490Help
Entry
DRW48_01490       CDS       T05723                                 

Definition
(GenBank) response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pars  Paracoccus sp. SC2-6
Pathway
pars02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pars00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DRW48_01490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pars02022]
    DRW48_01490
Two-component system [BR:pars02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   DRW48_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AXC48547
UniProt: A0A344PGP2
Position
complement(318015..318734)
Genome map
AA seq 239 aa AA seqDB search
MKDADGQVEAHILVVDDDQRIRDLLTRFLRRSGYLITCARDAAQARRLLTGLDFDMIVLD
VMMPGEDGLTLTRDLRRHVTTPILLLTARGDTDHRIAGLESGADDYLAKPFEPRELLLRI
AAILRRMPAVEARGPKYLALGGLRFDTTKSELWDGEALVRLTQTEAALMARLAATPGEAI
SRAELIDDLGRTPRENVGESSERAIDVQMTRLRRKIEVDPREPRYLQTVRGTGYMLVPD
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgccgatggccaggtcgaggcgcatattctggtcgtcgacgacgaccaacgt
atccgcgatttgctgacccggttcctgcgccggtcaggctatctgatcacctgcgcgcgc
gatgccgcgcaggcgcgccggctgctgaccgggctcgatttcgacatgatcgtgctggac
gtgatgatgccgggcgaggacggtttgacgctgacccgcgacctgcgccgccatgtcact
accccgatcctgctgctgacggcgcgaggcgataccgaccatcgcatcgccgggctggag
tcgggcgctgacgattacctcgccaagcccttcgagccgcgcgagttgctgctgcggatc
gccgcaatcctgcgccgcatgcccgccgtcgaggcgcgcggaccgaaatatctggcgctg
ggcggtctgcggttcgacaccaccaagagcgaactgtgggacggcgaggccttggtgcgc
ctgacccagaccgaggcggcactgatggcgcgcctcgccgccacccccggcgaggcgatc
agccgggccgagctgatcgacgatctgggccgcaccccgcgcgagaatgtcggcgagagc
agcgagcgggcgatcgacgtgcagatgacccgcctgcgccgcaagatcgaggtcgatccg
cgagagccgcgctacctgcagacggtgcgtgggaccggctacatgctggttccggactaa

DBGET integrated database retrieval system