KEGG   Paracoccus sp. SC2-6: DRW48_03215Help
Entry
DRW48_03215       CDS       T05723                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pars  Paracoccus sp. SC2-6
Pathway
pars00970  Aminoacyl-tRNA biosynthesis
pars01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pars00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DRW48_03215
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pars03029]
    DRW48_03215
Enzymes [BR:pars01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DRW48_03215
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DRW48_03215
Mitochondrial biogenesis [BR:pars03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DRW48_03215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AXC48831
UniProt: A0A344PHH6
Position
complement(658969..660294)
Genome map
AA seq 441 aa AA seqDB search
MDWLKATAVEQGQAMMAGVLDPVDQTEAYLAAAAAHPYGTRIYARMTPERARAEAIASHD
RARAGLRRGLLDGVALSWKDNIDSAGVATEAGSRLLAGRVPDRDAAALAAATASGLVCLG
KTHMTELAFSGLGVNPSTATPPNAYDPDLAPGGSSSGAAVSVALGLAAAAIGSDTGGSIR
LPAVWNGVTGFKPTPGALLAEGVVPLCRRFDAIGPIGRNVADCAAIFALLAGQKAPDLDG
LGIGDLRLLVLEGLPFDEIREAPAAAFEMAIDTLGRAGARISRAAPDCVREAAALTPVLF
TPEAYGLWKAQIEIAPDVMYPPILTRFRAGRDVSAADYVAGWDQLNRLRLRWAEAVAGYD
AVLLPTSAILPPDAAKLAGDEAFFAAENILALRNTRIGNLLGLPGISLPTQQPACGLMAM
GAVGDDRRLLVVADALEAALA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggactggttgaaggcgactgcggtcgagcaagggcaggcgatgatggccggcgtgctg
gacccggtggaccagaccgaggcttacctcgccgccgccgcggcccatccctatggcacg
cgcatttatgcccggatgacgcccgagcgcgcacgggccgaggcgattgcgtcgcatgac
cgggcgcgggccggtctgcgccgcgggctgctggacggggtcgccctcagctggaaggac
aatatcgacagcgccggggttgcgaccgaggcaggctcgcggctgcttgccgggcgcgtc
cccgatcgtgatgcggcggcactggcggcggccacggcctcggggctggtctgcctcggc
aagacccatatgacggagctggccttttccggcctgggggtgaacccctcgaccgcgacg
ccgccgaatgcctatgacccggacctcgcgcccggcggctccagcagcggcgcggctgtt
tccgttgcgctcggcctcgcggcggctgccatcggcagcgacactggcggctcgatccgg
ttgccggcggtgtggaacggcgtgaccggcttcaagccgacgccgggcgcgctgctggcc
gagggggtggtgccgctctgccggcggttcgacgcaatcggacccatcggccgcaacgtc
gccgattgcgccgcgattttcgcgctgctggccgggcaaaaggcacccgacctggacggg
ctcggcatcggtgatctgcgcctgctggtgctggagggactgccctttgacgagatccgc
gaggcgccggcagcggccttcgagatggcgatcgatacgctcggccgtgcaggcgcccgc
atcagccgcgccgcgcctgattgcgtgcgcgaggccgcggccctgacccccgtgctgttc
acccccgaggcctacgggctgtggaaagcgcagatcgagatcgcgcctgacgtgatgtat
ccgccgatcctgacccggttccgggccgggcgcgatgtatcggccgccgactatgtcgcg
ggctgggaccagctgaacaggctgcggcttcgctgggccgaggcggtggcggggtatgac
gcggtgctgctgcccaccagtgcgatcttgccgcccgatgcggcaaagctggcaggggac
gaggcgttcttcgcggcggaaaatatcctggcgctgcgcaacacgcgcattggcaacctg
ctggggctgccgggcatcagcctgcccacccagcagcccgcgtgcggcctgatggccatg
ggcgcggtcggcgatgaccgccgcctgctggtcgttgccgacgcgctggaggcggccctc
gcctga

DBGET integrated database retrieval system