KEGG   Paracoccus sp. SC2-6: DRW48_06375Help
Entry
DRW48_06375       CDS       T05723                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pars  Paracoccus sp. SC2-6
Pathway
pars03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pars00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DRW48_06375
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pars03011]
    DRW48_06375
Ribosome [BR:pars03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DRW48_06375
  Bacteria
    DRW48_06375
  Archaea
    DRW48_06375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AXC49365
UniProt: A0A344PJ10
Position
1319258..1319740
Genome map
AA seq 160 aa AA seqDB search
MGKEQNPRRVADNEAFAKTSMLRTSPQKLNLVAAMIRGKKVDKALADLTFSKRRIAGDVK
KCLQSAIANAENNHNLDVDQLVVAEAWVGKGMVLKRGRPRARGRFGKIMKPFSEITIKVR
EIDVAAAEAAKKAARAKRATASNRQAAATASAPEAAEELA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggaacaaaacccgcgccgcgtggccgacaacgaggctttcgcaaagacctcg
atgctgcgcacgtcgccgcagaaactgaacctggtcgcagccatgatccgcggcaagaaa
gtcgacaaggcgcttgccgatctgaccttctccaagcgccgcatcgccggcgacgtgaag
aagtgcctgcagtcggccatcgccaatgccgagaacaaccacaacctcgacgtcgaccaa
ctggtcgtggccgaggcctgggttggcaagggcatggtcctcaagcgtggccgcccgcgt
gcgcgcggtcggttcggcaagatcatgaagcctttctcggagatcacgatcaaggtccgc
gagatcgacgtcgcggcggccgaggcggccaagaaggccgcccgcgccaagcgtgcgacc
gcgtcgaaccgtcaggcggctgcaaccgcctccgcccccgaagctgccgaggagctcgcg
taa

DBGET integrated database retrieval system