KEGG   Paracoccus sp. SC2-6: DRW48_14695Help
Entry
DRW48_14695       CDS       T05723                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pars  Paracoccus sp. SC2-6
Pathway
pars00260  Glycine, serine and threonine metabolism
pars01100  Metabolic pathways
pars01110  Biosynthesis of secondary metabolites
pars01120  Microbial metabolism in diverse environments
pars01130  Biosynthesis of antibiotics
pars01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pars00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DRW48_14695
Enzymes [BR:pars01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DRW48_14695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AXC50760
UniProt: A0A344PN05
Position
3030162..3031232
Genome map
AA seq 356 aa AA seqDB search
MIDLFSDTKSRPSEAMRRFMMRAEVGDEQKDEDPTVRTLCERVADMLGKESAVYLPSGTM
CNEISLAVHCRPGEEVICDRSSHIIHYEAGGPAALSGVMIRTVDGHNGIFNAEQLGAAIR
PESRYAPRSRLVCVEQTANLAGGRIWPLETIREVMTVARQAGLSGHLDGARLLNAVAATR
VAARSYAEPFDSAWIDLTKGLGAPVGAVLAGSRDFIREAWRLKQMWGGAMRQAGIIAAAG
VYALDHNVNRLVDDHDNAQRLARGLAQMDGIGLDPADVETNMVFFDVAGTGLTAAEIVAV
ARERGVLIGAFGPSTIRAVTHIDVSEADVDVALQVLGGIVEDAGRIGTKKLAAAHS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctgttcagcgataccaaatcgcgtcccagcgaagccatgcggcgcttcatg
atgcgggccgaagtcggcgacgagcagaaggacgaggatccgaccgtgcgcacgctgtgc
gagcgcgtggccgacatgctgggcaaggaatccgccgtctacctgccctccggcacgatg
tgcaacgaaatctcgctggccgtgcattgtcgccccggcgaggaagtgatctgcgaccgc
agttcgcacatcatccattacgaggccggcggcccggccgcgctctcgggcgtgatgatc
cgtaccgtcgacggccacaacggcattttcaacgccgagcagctcggtgccgcgatccgc
cccgagagccgctatgccccccgcagccggctggtctgcgtcgaacagaccgcgaacctc
gccggcggtcgcatttggccgctggagacgatccgtgaggtcatgacggtggctcggcag
gcgggcctttcgggtcacctcgatggcgcacgtcttctgaacgccgtagcggccacccgc
gtcgccgcacgctcctatgccgagcctttcgattcggcatggatcgacctgacaaagggc
ctcggcgcgccggttggggccgttctggccggctcgcgcgatttcatccgcgaggcctgg
cgcctcaagcagatgtggggcggcgcgatgcgccaggccggcatcatcgccgcggccggg
gtctatgcgctggaccacaacgtcaaccgtctggtcgacgatcacgacaacgcccagcgc
ctcgctcgcggccttgcgcagatggacggcatcggcctcgacccggcggacgtggaaacc
aacatggtgttctttgacgtcgcgggcaccggccttaccgctgccgagatcgtcgcggtc
gcgcgcgaaaggggcgtgctgataggcgccttcggccccagcaccatccgcgccgtgacg
catatcgatgtgagcgaagccgatgtcgatgttgcgctgcaagtccttggcggcatcgtc
gaggatgcggggcggatcgggaccaagaagctcgccgcggcgcacagctga

DBGET integrated database retrieval system