KEGG   Pseudoalteromonas arctica: PARC_a0970Help
Entry
PARC_a0970        CDS       T05179                                 

Gene name
putA
Definition
(GenBank) proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
part  Pseudoalteromonas arctica
Pathway
part00250  Alanine, aspartate and glutamate metabolism
part00330  Arginine and proline metabolism
part01100  Metabolic pathways
part01110  Biosynthesis of secondary metabolites
part01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:part00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PARC_a0970 (putA)
   00330 Arginine and proline metabolism
    PARC_a0970 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:part03000]
    PARC_a0970 (putA)
Enzymes [BR:part01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     PARC_a0970 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     PARC_a0970 (putA)
Transcription factors [BR:part03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    PARC_a0970 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ATC85649
UniProt: A0A290S137
Position
I:complement(943350..947153)
Genome map
AA seq 1267 aa AA seqDB search
MLFNGDLTTICPIRQRIRDFYRIDENAVIDHILPLAEVGVKARSRAWERARQIVLNIRKE
QDGQGGVDALLNEFSLSSEEGVVLMCLAEALLRVPDKATQDVLIRDKLAKGDWSSHLGSS
DSLFVNASSWGLLVTGKMVNYTDKTKEQQFGMLKKTIGRLGEPVIRKSVNFAMKIMGKQF
VMGRTIDEAIERAADTEQKGYVYSYDMLGEGARTMKDAKRYFDSYMNAIHSIGKAANGRG
PIKSPGISVKLSAIHPRYEFTHKDRVMEEIVPKLKELALAAKKYDIGFTVDAEEADRLDI
SLDVIEAVFSDEDLGDWQGFGLAVQAYQKRAIFVIEWLTDLATRVGRKMMVRLVKGAYWD
TEIKTTQQDGLEHFPVFTRKATTDVSYKACAIKMLEARDVLYPQFATHNAYTAATILEVA
KGDNTGFEFQRLHGMGESLFDQIVNEEKIQCRVYAPVGQHEDLLAYLVRRLLENGANSSF
VNAIVDTTKPVESLLPDPVETLQGLRNKYNTQIKMPIDLYGEERANSKGMDLTDINVITP
FKENLETWFNEHLIEQSQVPEGSLAVKNPANHKEIIGHVKLQTGEEMKVLLANAEAALES
WSQTPVKERANLLRRVADILERHHDELVAICIKEAGKVAQDGIDEVREAVDFCRYYAARA
EELSKDERFEARGVILCISPWNFPLAIFLGQVAAAIVTGNTVIAKPAEQTSLIALRAIEL
MLSVGLPEHVVQPVIARGSEVGKTIVPDERIQAVMFTGSTETGTLISQTLAARNDIQVPL
IAETGGQNCMIVDSTALPEQVVDDVISSGFQSAGQRCSALRVLFIQDDVADGIIEMLKGA
LAELHIGDPSLLSTDVGPVIDEKALKNLNEHVEYLKGNSILHYECKIPDNTQNGAYFFAP
RLYEIKDLSVLKREVFGPCVHIVRFKSNELDDVMDQINNTGYGLTMGVHSRIEERCEYLA
KMSRAGNVYINRNMIGAIVGVQPFGGRGLSGTGPKAGGPNYLQRLVKEKASPDNVQMTNL
TPDELDLHHYSGANEQVKKLMANSMRDEKIWRATPLNDRVSAVRQLLAKIATVEIIDDLA
DDLALTLSEARAQLNRLEKHMRKFTTLPGPTGESNTLHLEARGCVVCYADKSTSFNFWAL
SIITAIAAGNTVITVASELFYDEAVAFKDKFISTGVAEGVFQVAKPNQLQAILAHPHLAG
AVVAARSSRLGYFSQQLAQRKGAILPVISSEYYDTLIKRLITEKTISIDTTASGGNTSLM
TLVEDDE
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgttattcaacggcgatttaacaacgatttgtcctattagacaaagaatccgtgacttc
taccgcatagatgaaaatgcggttattgatcatattttaccgcttgcagaagtaggcgta
aaagcacgaagtcgtgcctgggaaagagcccgccagattgttttaaacattcgtaaagag
caagatgggcaaggcggtgttgatgcgcttttaaatgaattttcactctctagtgaagaa
ggcgttgtattaatgtgtttggccgaagcactgcttcgcgtaccagataaagcgactcaa
gatgtacttattcgtgacaagttagcgaaaggtgattggagctctcatttaggcagcagc
gattctttattcgtaaacgcgtcttcttggggattattagttaccggtaaaatggttaac
tacacagacaaaacgaaagaacaacagttcggcatgcttaaaaagaccattggtcgttta
ggtgagccagttattcgtaagtctgtaaattttgctatgaaaattatgggtaagcaattc
gttatgggtcgtaccattgacgaagcaattgaacgtgctgccgatacagagcaaaaaggt
tatgtatattcttacgatatgctaggcgaaggcgcgcgcacaatgaaagatgcgaagcgt
tactttgacagctacatgaatgctatacactcgattggtaaagcggcaaatggtcgtggt
ccaattaagagccctggtatttcagttaagctttctgctattcatccacgttatgagttc
actcataaagaccgtgtgatggaagaaatagtccctaagttaaaagaacttgcgcttgct
gctaagaaatacgatatcggctttaccgttgatgctgaagaagctgaccgtttagatatt
tcattagatgtcattgaagcggtatttagtgatgaagatcttggtgattggcaaggattt
ggcttagcggttcaagcgtaccaaaaacgcgctatttttgtaattgaatggctaacagac
cttgcaacacgtgttggtcgtaagatgatggtacgtttagttaagggcgcgtactgggat
actgaaatcaaaaccacacaacaagatggtttagagcatttccctgtatttactcgtaaa
gcaacaaccgatgtttcttacaaagcatgtgcaattaaaatgcttgaagcgcgcgacgta
ctttatccacaatttgctacacataacgcttacactgccgcgactattttagaagtagcg
aaaggcgataacacaggttttgaatttcaacgtttgcacggtatgggtgaatcattattc
gaccaaatcgttaacgaagaaaaaattcaatgtcgtgtatatgcaccggttggtcaacac
gaagacctacttgcttaccttgttcgtcgtttgttagaaaatggtgctaactcatcattt
gtaaacgcgattgtagatacaacaaaacctgttgaatcattactaccagaccctgtagaa
acactgcaaggcctgcgtaacaagtacaatacgcaaatcaaaatgccaattgatttatac
ggtgaagaacgtgctaactctaaaggcatggatttaaccgatattaacgttattacccct
ttcaaagagaatcttgaaacatggtttaatgagcacttaattgagcaaagccaagtacca
gaaggctcattggctgttaaaaacccagcaaatcacaaagaaatcatcggccacgttaag
ttacaaactggcgaagagatgaaagtattactggctaacgctgaagcggcacttgaatca
tggtcacaaacaccagtaaaagagcgtgctaatttactgcgtcgcgttgctgacatttta
gagcgtcatcatgatgaactagtcgctatctgtattaaagaagcgggtaaagtagcgcaa
gatggtattgatgaagtacgtgaagcggttgatttttgtcgttactacgcagcgcgcgct
gaagagttatctaaagatgagcgttttgaagcccgtggcgttattttatgtattagcccg
tggaacttcccgcttgcaatatttttaggtcaagttgctgctgcgattgttacaggtaac
actgtaattgctaagcctgctgagcaaacaagtttaatcgcccttcgtgccattgaacta
atgctatctgttggtttacctgagcacgttgttcaacctgttatcgctcgcggctcagaa
gtaggtaaaacaattgttccagatgagcgcattcaagcggttatgtttacaggttctact
gaaacaggcacattaatttctcaaacacttgctgcacgtaacgatattcaagtaccgtta
attgcagaaacaggtggccaaaactgtatgattgttgactcaacggcgcttcctgagcaa
gtagttgacgatgtgatcagttctggttttcaaagtgctggccaacgttgttctgctctt
cgtgttttattcattcaagatgacgtagcagatggcattatcgaaatgcttaaaggcgct
ctagctgagttacacattggcgacccatcgttactatcaactgatgttggtccggtaatt
gatgaaaaagcacttaaaaacttaaatgaacacgttgagtacttaaaaggtaattctata
cttcattacgaatgtaaaattcctgataatactcaaaatggcgcatacttttttgctcct
cgtttatacgaaattaaagacttatcagtacttaaacgtgaagtatttggcccatgtgtt
catattgttcgctttaaatcgaatgaacttgatgatgtgatggatcaaataaataacacg
ggctatggtctgacaatgggtgttcactcacgtattgaagagcgctgtgagtaccttgct
aaaatgtcacgtgcgggtaatgtttacattaaccgaaacatgattggtgccattgttggt
gtgcaaccgtttggtggccgtggtttatcaggtactggccctaaagccggtggccctaac
tacctacaacgtttagtaaaagaaaaagcatcaccagataacgtacaaatgactaaccta
acgcctgacgaacttgatttacaccactacagcggtgcgaatgagcaagttaaaaagcta
atggctaactcaatgcgcgatgagaaaatctggcgtgcaacaccactaaacgaccgtgtt
tcggctgtacgtcagttgcttgctaaaatcgcgacggtagaaattatcgacgatttagca
gacgacttagcattaacattatcagaagcacgtgcacagcttaaccgccttgaaaagcac
atgcgtaagtttactaccctgcctgggccaacgggtgagtctaatacacttcatctagaa
gcacgtggttgtgtagtgtgttatgcagataagagcacatcatttaacttctgggcattg
tctatcatcactgctattgccgcaggtaatacggtaattactgtagcgtctgagctgttt
tatgatgaagccgttgcctttaaagataaatttatctctacaggtgttgcagaaggtgtt
ttccaagtagctaaacctaaccagttacaagctattttggcgcaccctcatttagccggt
gcggtagttgctgctcgctcgtctcgcttgggctactttagtcaacagcttgcacagcgt
aaaggtgctattttaccagtaattagctctgagtattacgatacattaatcaaacgtctt
attactgaaaaaacaatcagtattgatacaacagcatcaggtggtaacacatcactaatg
acgcttgttgaagatgatgaataa

DBGET integrated database retrieval system