KEGG   Pseudoalteromonas arctica: PARC_a1496Help
Entry
PARC_a1496        CDS       T05179                                 

Gene name
nfnB
Definition
(GenBank) nitroreductase / dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
part  Pseudoalteromonas arctica
Pathway
part00633  Nitrotoluene degradation
part01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:part00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PARC_a1496 (nfnB)
Enzymes [BR:part01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     PARC_a1496 (nfnB)
  1.-  
   1.-.-  
    1.-.-.-  
     PARC_a1496 (nfnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ATC86112
UniProt: A0A290S219
Position
I:complement(1461311..1461967)
Genome map
AA seq 218 aa AA seqDB search
MTHPIINDLEKRYTAKRYDATKRVSQDDLAVIYEAMRLSPSSINSQPWKFIVIESDEAKE
RMHSTFANKFAFNQPHIKTASHIILFAHNPKYTRDDYAQVIDADIKNGRTKAENREQAFG
AYAFVDMNTDEQGNNEEWTKAQTYIALGNTMHAAARLGVDSTPMEGVDAELIGEVFEKEL
DGYVCDVALVLGYHDSAEDYNAKLPKSRLAKEQVIQVL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactcaccctattattaatgacttagaaaagcgctacacagcaaaacgttatgatgca
acgaaacgtgtatctcaagacgatttagccgttatttacgaagctatgcgcctgtctcct
tcatctattaactcgcagccttggaaattcatcgtaattgaatcagatgaggctaaagag
cgtatgcatagtacatttgctaataaatttgcgtttaaccagccacacattaaaacagct
tcgcatataatattatttgctcacaaccctaaatatacccgcgatgattacgcacaagta
attgatgcagatattaaaaatggtcgtactaaagcagaaaatcgcgaacaagcttttggt
gcttacgcgtttgttgatatgaatactgatgagcaaggcaataatgaagagtggactaaa
gcacaaacttatattgcactgggtaacactatgcatgcagctgcacgcttaggtgttgac
tctactccaatggaaggcgtagatgccgagctgattggcgaagtttttgaaaaagaactc
gatggttacgtatgcgacgtagcattagtacttggctatcacgatagcgcagaagactat
aatgctaaattacctaaatctcgcttggcaaaagagcaagttattcaggttttataa

DBGET integrated database retrieval system