KEGG   Pseudoalteromonas arctica: PARC_a3181Help
Entry
PARC_a3181        CDS       T05179                                 

Gene name
fbaA
Definition
(GenBank) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
part  Pseudoalteromonas arctica
Pathway
part00010  Glycolysis / Gluconeogenesis
part00030  Pentose phosphate pathway
part00051  Fructose and mannose metabolism
part00680  Methane metabolism
part01100  Metabolic pathways
part01110  Biosynthesis of secondary metabolites
part01120  Microbial metabolism in diverse environments
part01130  Biosynthesis of antibiotics
part01200  Carbon metabolism
part01230  Biosynthesis of amino acids
Module
part_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:part00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PARC_a3181 (fbaA)
   00030 Pentose phosphate pathway
    PARC_a3181 (fbaA)
   00051 Fructose and mannose metabolism
    PARC_a3181 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    PARC_a3181 (fbaA)
Enzymes [BR:part01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PARC_a3181 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ATC87595
UniProt: A0A290S7E2
Position
I:complement(3115309..3116373)
Genome map
AA seq 354 aa AA seqDB search
MALISMRQLLDHAAEHGYGVPAFNVNNQEQMRAIMEAADKTNSPVIVQGSAGARAYAGAP
FIRHMILAAVEEWPHIPVVMHQDHGTSPGVCQRSIQLGFSSVMMDGSLMSDGKTPSSYEY
NVEVTRETVAMAHACGVSVEGELGVLGSLETGEAGEEDGVGAEGLLTTEQMLTDPEEAAD
FVNKTHVDALAIACGTSHGAYKFTRPPTDDILAIDRIKAIHARIPNTHLVMHGSSSVPQE
WLEIINQYGGEIPETYGVPVEQIVEGIKFGVRKVNIDTDLRLASTGAIRRHMALNPSNFD
PRKYLAEATKAMTEICVARYNSFGTSGQASKIKPISLDEMHLKYLSGELDPKIR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggctttaatcagtatgcgacaacttttagatcatgcagcagagcatggttacggcgta
cctgcttttaacgttaacaatcaagagcaaatgcgcgcaataatggaagcggctgacaaa
acaaacagcccagtaatcgttcagggatcagctggcgcacgtgcttatgctggtgctcca
tttattcgtcatatgattttagcagccgttgaagaatggccacatatccccgttgttatg
caccaagatcacggcacatcgccaggtgtatgtcagcgttcaattcagcttggtttttca
tcagtaatgatggatggctcgttaatgagcgacggtaaaactccttcaagctacgaatac
aatgtagaagtaacgcgcgaaactgttgctatggctcatgcttgtggcgtatctgttgaa
ggcgagctaggtgtacttggttcactggaaacaggtgaagctggcgaagaagacggtgtt
ggcgcagaagggttactaaccactgagcaaatgctaacagaccctgaagaagcggctgac
tttgtaaataaaacacatgttgatgcacttgcaattgcctgtggtacttcgcatggagct
tataaatttactcgcccaccaacagatgacattttagcgattgatcgcattaaagcgatt
catgcacgtattcctaacacgcatttagtgatgcatggttcatcttcagttcctcaagaa
tggttagaaattattaatcagtatggtggcgagattccagaaacttatggtgtgccagtt
gaacagattgttgaaggcattaagtttggtgttcgtaaggtaaatattgataccgattta
cgtttagcatctaccggtgcaattcgccgtcatatggcgcttaacccatctaacttcgat
ccacgtaaatacttagctgaagcaactaaagcaatgacagagatttgtgttgcacgctat
aactcgtttggtacttctggtcaggctagtaaaattaagccaatttcacttgatgaaatg
caccttaaatacttaagcggcgagctagaccctaaaattagataa

DBGET integrated database retrieval system