KEGG   Paracoccus sp. CBA4604: CYR75_11515Help
Entry
CYR75_11515       CDS       T05276                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
paru  Paracoccus sp. CBA4604
Pathway
paru00270  Cysteine and methionine metabolism
paru00480  Glutathione metabolism
paru01100  Metabolic pathways
Module
paru_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:paru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CYR75_11515
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CYR75_11515
Enzymes [BR:paru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     CYR75_11515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD GSP_synth
Motif
Other DBs
NCBI-ProteinID: AUM74821
UniProt: A0A2K9MGP5
Position
complement(2360891..2361850)
Genome map
AA seq 319 aa AA seqDB search
MSLNVALQMDPIEHVSVDADSTFRIGIEAQARGHRLFQYTFDRLSYDEGRVKAVGRPVSL
KAEQGNHVDFGEWQTVDLGRFDVVWLRQDPPFDMGYVTSTHLLDRVSEDVLVVNDPFWVR
NCPEKLMVLDFPELTPATLITRDLDLIREFRARHGDIIVKPLYGNGGAAVFHLRPEDPNL
SALIEFFGGVNREPVIVQRYLAAVSKGDKRIILVDGEAVGAINRVPAAGEARSNMHVGGR
PEKTQLTEREHEICEIIGPTLREKGLLFTGIDVIDGWLTEINVTSPTGLLELERFDGINA
AALIWDAIEARLEKRRIRD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaatgtcgccctgcagatggaccccatcgagcatgtctcggtcgatgcggac
agcacctttcgcatcgggatcgaggctcaggcgcgggggcaccggctgtttcaatatacc
ttcgaccggctgagctatgatgagggtcgggtgaaggccgtgggccggccggtgtcgttg
aaggccgagcagggcaatcatgtcgacttcggcgagtggcagacggtcgatctcggccgc
ttcgatgtggtctggctgcgtcaggacccgccctttgacatgggctatgtcacctcgacc
catcttctggaccgggtcagcgaggatgtgctggtcgtcaacgatccgttctgggtgcgg
aactgcccggaaaagctgatggttctggattttccggagctgacgccggcgacgctgatc
acccgcgacctcgacctgatccgcgagttcagggcccgccacggcgacatcatcgtcaag
ccgctttacgggaatggcggggcggcggtgttccatctgcggcccgaggacccgaacctg
tcggcgctgatcgagttcttcggcggcgtcaaccgagagccggtgatcgtgcagcgctat
ctggcggcggtatccaagggcgacaagcggatcattctggtcgacggcgaggctgtcggc
gcgatcaaccgcgttccggccgcgggtgaggcgcggtcgaacatgcatgtcggcgggcgg
cccgaaaagactcagttgaccgagcgcgagcatgagatctgcgagatcatcgggccgacg
ctgcgcgaaaaaggcctgctgttcaccggcatcgacgtgatcgacggctggctgaccgag
atcaacgtcacctcacccaccgggctgctggaactggaacggttcgacgggatcaacgcg
gctgcgctgatctgggacgcgatcgaggcgcggctggagaagcgccgaatccgagactga

DBGET integrated database retrieval system