KEGG   Paracoccus sp. CBA4604: CYR75_14975Help
Entry
CYR75_14975       CDS       T05276                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
paru  Paracoccus sp. CBA4604
Brite
KEGG Orthology (KO) [BR:paru00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CYR75_14975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AUM75427
UniProt: A0A2K9MIG5
Position
3114307..3115773
Genome map
AA seq 488 aa AA seqDB search
MPGTDLKSWKTLNKDLARFASLEQAAAYVSRPLVAPGIALAFMVLVGLTVAGFAGITPAT
AIVIAAAVVGAYMALNIGANDVANNMGPAVGARAMTIGSALIIAAICETAGALLAGGEVV
STISRGIVAPEAVAQPGVFVWAMFSALLAGALWINLATWIGAPVSTTHAIVGGVMGAGIA
AAGFGAVNWPTMGAIVASWVISPLLGGVIAAMFLAFIKTRIIYTPDILHSARRWVPLLIG
IMAGTFAAYLALKGLSKVWDVGLGLALQIGLVVAVLTALVMRPIIARQSVGLENRKKSLK
ELFAIPLVLSAALLSFAHGANDVANAVGPLAAIVHAVQDGTSGDQVQIPLWVMLIGALGL
SVGLLLFGPKLINIVGNEITRLNAVRAYCVALSAAVTVIIASWLGLPVSSTHIAIGGIFG
VGFFREWYHEKIIGERRDDTESSPELRRRRKVVRRTHFTTILAAWVITVPASALLSAGLF
LLFLRFWH
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgccgggaaccgatctgaaaagctggaagacgctgaacaaggatctcgcgcgtttcgcc
agtctcgagcaggctgcggcctatgtctcgcggccgctggtcgcgccgggcatcgcgctg
gccttcatggtgctggtcgggctgaccgtcgccggcttcgccgggatcaccccggccacg
gccattgtcatcgcggcggcggtggtgggcgcctatatggcgctgaacattggcgcgaac
gacgtcgccaacaatatgggcccggcggtgggcgcgcgggccatgaccatcggcagcgcc
ctgatcatcgccgcgatctgcgaaaccgcgggcgcgctgctggcggggggcgaggtcgtg
tcgaccatctcgcgcgggatcgtcgcgcccgaggcggtggcccagcccggcgtcttcgtc
tgggcgatgttctcggcgctgctggcgggggcgctgtggatcaacctcgccacatggatc
ggcgccccggtctcgaccacccacgccatcgtcggcggggtcatgggcgcgggcatcgcc
gcggcagggttcggcgcggtcaactggccaaccatgggcgcgatcgtcgccagctgggtg
atctcgcccctgctgggcggggtgatcgcggcgatgttcctggccttcatcaagacccgc
atcatctatacgcccgacatcctgcactcggcccggcgctgggtgccgctgctgatcggc
atcatggccggcaccttcgccgcctatctggcgctgaaggggctgagcaaagtctgggat
gtggggctgggcctcgcgctgcaaatcgggctggtcgtggcggtgctgacggcgctggtc
atgcgcccgatcatcgcgcggcagtcggtcgggctggagaaccgcaagaaatcgctgaag
gagctgttcgcgatcccgctggtcctgtcggcggcgctgctgtccttcgcccatggcgcg
aatgacgtggccaacgcggtcgggccgctggcggcgattgtccatgcggtgcaggacggc
acctcgggcgatcaggtgcagatcccgctgtgggtcatgctgatcggggcgctggggctg
tcggtcgggctgctgctgttcgggccgaagctgatcaacatcgtcggcaacgagatcacc
cggctgaacgcggtgcgcgcctattgcgtggcgctgtcggcggcggtgacggtcatcatc
gcgtcgtggctggggctgccggtcagctcgacccatatcgccatcggcggcattttcggc
gtcggcttcttccgcgaatggtatcacgagaagatcatcggcgagcgccgcgacgacacc
gaatcctcgccagagctgcgccgccgccgcaaggtcgtgcgccgcacgcatttcaccacc
atcctcgcggcgtgggtcatcacggtgccggcctcggcgctgctgtcggcagggttgttc
ctgctgttcctaaggttctggcactga

DBGET integrated database retrieval system