KEGG   Muribaculum intestinale: A4V02_08120Help
Entry
A4V02_08120       CDS       T04438                                 

Definition
(GenBank) tRNA glutamyl-Q(34) synthetase GluQRS
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
pary  Muribaculum intestinale
Pathway
pary00860  Porphyrin and chlorophyll metabolism
pary00970  Aminoacyl-tRNA biosynthesis
pary01100  Metabolic pathways
pary01110  Biosynthesis of secondary metabolites
pary01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pary00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A4V02_08120
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A4V02_08120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pary01007]
    A4V02_08120
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pary03016]
    A4V02_08120
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:pary02048]
    A4V02_08120
Enzymes [BR:pary01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     A4V02_08120
Amino acid related enzymes [BR:pary01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   A4V02_08120
Transfer RNA biogenesis [BR:pary03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A4V02_08120
 Prokaryotic Type
   Other AARSs
    A4V02_08120
Prokaryotic defense system [BR:pary02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    A4V02_08120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ANU63697
UniProt: A0A1B1SA76
Position
complement(1909713..1910627)
Genome map
AA seq 304 aa AA seqDB search
MLDILCNTAVSAGCGRWKGRFAPSPSGRMHLGNVYAALMSYVSAKAKGGSWLLRIEDIDR
QRSRQMWADMIMSDLDWLGLGWDEGPIYQSARDDAYMSYLERLAGMGLVYPCVCTRADLM
ASRAPHASDGHVAYSGRCRPSTPCYGAVAAEANLRLMVPPCPGGPDSDEVSFDDLICGRQ
NVALSCYFGDFVLRRKGGDWAYQFAVAVDDADMGVTEVVRGDDLLMSTAPQRYVMSLLEL
PEPVVYAHLPLLKNSDGVRLSKRDRALSMEWLRANCYPRDVIVAVCRAAAVNPEEMLSVL
ERLR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatatactctgtaatactgctgtttctgccggatgcggacgttggaaaggccgc
tttgcgccttctccctccgggcggatgcatctcggcaatgtctatgccgctttgatgtcg
tatgtgtcggccaaagctaagggcggaagctggcttctgcgcatagaggatattgaccgt
cagcgttcgcggcagatgtgggccgatatgataatgtctgatctcgactggcttggactg
ggctgggatgagggtccgatatatcaaagtgcacgcgatgacgcatatatgtcatatctt
gagcgccttgcggggatgggacttgtatatccatgtgtatgcacgcgcgccgacctgatg
gcatcgagggctccacatgcttccgacggacatgtggcttactccgggcgttgtcgcccg
tcgacgccatgctatggtgctgtcgccgcagaggcgaatctacgtctcatggtgcccccc
tgtccgggcgggccggatagtgatgaggtgtcatttgacgatttgatttgtgggcgtcag
aatgtggcgctgtcctgttatttcggcgattttgtgctccggcgcaagggaggtgactgg
gcgtatcagtttgccgtggctgtcgacgatgccgatatgggtgtcacggaggtggtgcgt
ggagatgatttgcttatgtctacagcccctcagcgttatgtcatgtcattgctggaactg
ccggagcctgtggtatacgctcatcttccacttcttaaaaattccgatggcgtgaggctg
tccaagcgcgacagagccttgtcaatggaatggctgcgggccaattgctatcctcgcgat
gtgattgtagctgtatgcagagctgccgcggtcaatccggaagagatgctgtcggtgctt
gaacggctgaggtaa

DBGET integrated database retrieval system