KEGG   Muribaculum intestinale: A4V02_11795Help
Entry
A4V02_11795       CDS       T04438                                 

Definition
(GenBank) hypothetical protein
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pary  Muribaculum intestinale
Pathway
pary00010  Glycolysis / Gluconeogenesis
pary01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4V02_11795
Enzymes [BR:pary01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     A4V02_11795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ANU64330
UniProt: A0A1B1SC98
Position
2848855..2849484
Genome map
AA seq 209 aa AA seqDB search
MIRNLLFDLGGVIMDIERERCVNAFRQLGMDNIGDFLGDYGQKGAFGQLEEGLISPAEWR
EEVRRNIPHEVTDAQIDEAFNSFLIGIPIHRLEALRELHKHYRLYLLSNTNSVMWNSKIA
ESFTAEGLTVNDYFDGITTSFEAKAMKPAPEIFRKVADDYAILPEETIFFDDSLANCKSA
GELGFQYIHVAPGTEFKALLAEKISRDSN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatacgaaaccttctctttgaccttggcggagtgataatggatatcgaacgcgaacgc
tgcgtgaacgctttccggcagcttggcatggacaatatcggcgatttcctcggcgactat
ggccagaaaggcgcgttcggtcagctcgaagagggacttatctcacccgcagaatggcgc
gaagaagtgcgccgcaacatcccacatgaagtaacggacgcacagattgacgaggctttc
aacagcttcctcatcggcatccccatccaccgtctggaggcactgagagaactccacaag
cattatcgtctgtatctgctcagcaacaccaactccgtgatgtggaactctaaaatcgcc
gagtcttttacagccgaaggccttaccgtaaatgattacttcgacggaatcaccacctca
ttcgaggctaaagcgatgaagccggcacccgagatattccgcaaggtagccgacgactac
gcaatactgcctgaggagacaatattctttgacgactcactggccaactgcaagagtgcc
ggcgagctcggattccaatatatacatgtagctccgggcacagaattcaaggccctcctg
gccgaaaaaatcagccgcgactccaactga

DBGET integrated database retrieval system