KEGG   Pyrobaculum arsenaticum: Pars_0167Help
Entry
Pars_0167         CDS       T00503                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00340  Histidine metabolism
pas01100  Metabolic pathways
pas01110  Biosynthesis of secondary metabolites
pas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Pars_0167
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Pars_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABP49782
UniProt: A4WHB5
Position
complement(152469..153578)
Genome map
AA seq 369 aa AA seqDB search
MRRGFPRDVLETAGKIIDDVRDGGLDAALKYSERLDGEAPREVLIAPRPGGDPSVVGAAL
EAARSLEALYRKLAPPSAVDYYGGVLRTVVWKPVRRAALYVPARYVSTLVMLAMPAKAAG
VEELYVVTPPRGVTGEVLGVAKELGIKAVLALGGAHGLAYAAFHLGVDMLAGPGGLYVQA
AKFLLSQYVGIDGIEGPTELVVYAEGVPPETAARGALAQLEHGPTSFAYVLSTDASLLKG
VEEVYKREKTSSMGPLETRQVSSVEEAVEFIDTVAPEHLEVWGRRDVAYRVRNVGAVSVN
MPSPYLDYVAGISHVLPTGGTARWRGIITPLTFMKAVGIAEAVGEIKLAEAARRLAQYEG
FQLHYRALL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggggctttccccgcgacgtgcttgaaaccgccggcaagataatcgacgatgtc
agagacggcgggctcgacgccgctcttaaatactccgagaggctcgacggcgaggcgccg
agggaggtcctaatcgcgccgcggcctgggggcgaccccagcgtggtgggggcggcgctg
gaggcggcccgctcccttgaggcgctttacaggaagctggcaccgcccagcgctgtggac
tactacggcggcgtcctcagaacggttgtgtggaagccggtgaggagggcggcgctatac
gtcccggcgcgctacgtctccaccctcgttatgctggccatgccggcgaaggcggcgggt
gtcgaggagctgtacgtggttactccccccaggggggttacgggggaggtcctcggagtg
gcgaaagagctggggatcaaggcggttttggcgctgggcggggcccacggccttgcatac
gccgccttccacctcggcgtggacatgttggcgggccctgggggtctctacgtccaggcc
gccaagttcctcctctcccagtacgtggggattgacgggattgaggggccgacggagctt
gtggtatacgcagagggcgtgccgcccgagacggcggcgcgcggcgccttagcccagctg
gaacacggcccgacctccttcgcctacgtcctatccaccgacgcctccctcctaaaaggc
gtcgaggaggtgtacaagagggagaagacctcgtccatgggccccctagagacgcggcag
gtgtcaagcgtggaggaggctgtggagttcatcgacacggtagcgccggagcacttggag
gtctggggccggcgggacgtagcgtatagggttaggaacgtgggggcggtctcggtgaat
atgccctccccctacctcgactacgtggccggcattagccacgtcttgccaacaggcggc
acagcgaggtggcgcgggataatcacgccgctgaccttcatgaaggctgtcggcatcgcc
gaggccgtcggcgaaattaagctggccgaggcggctaggaggctggcgcagtacgagggc
tttcagctccactatagggcgttgttatga

DBGET integrated database retrieval system