KEGG   Pyrobaculum arsenaticum: Pars_0396Help
Entry
Pars_0396         CDS       T00503                                 

Definition
(GenBank) succinate semialdehyde reductase (NADPH)
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00010  Glycolysis / Gluconeogenesis
pas00071  Fatty acid degradation
pas00350  Tyrosine metabolism
pas00625  Chloroalkane and chloroalkene degradation
pas00626  Naphthalene degradation
pas01100  Metabolic pathways
pas01110  Biosynthesis of secondary metabolites
pas01120  Microbial metabolism in diverse environments
pas01130  Biosynthesis of antibiotics
pas01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_0396
  Lipid metabolism
   00071 Fatty acid degradation
    Pars_0396
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pars_0396
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pars_0396
   00626 Naphthalene degradation
    Pars_0396
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pars_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Glu_dehyd_C Sacchrp_dh_NADP TrkA_N XdhC_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABP49998
UniProt: A4WHY1
Position
346613..347671
Genome map
AA seq 352 aa AA seqDB search
MKIPVKIKAAVYKSPGQPLELSEIPTPTPGEGEVLIKVAATGVCHSDLHVLDGEMIPPPE
GFILGHEVSGWVVEFGPRCENPHGLSPGDPVVVSWIIPCGKCYWCVRGQENYCPYAAARM
PGLVGINGGHAEYMTVPETAIYPIPKGLDVHNAAVISCAYGTAYRALKEAGVGPGTSLVV
VGAGGVGLAAVELAVALGAYPIVAVDVREAALKKAQEVGASHVINAAERNAIGAIREALP
QGTDVVYETKPNPDLKIALEVVRRGGTIVVTGLGASTIEIPAMHLVMNGIRIVGSLGYKP
RTDIPELLALAAVGKIKPEKIISHRYKPENINEAYNNLRQGKHHRALIIWNP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgaagattcccgtcaaaataaaagcggcggtatacaaatcacccggccagccgcttgag
ctctccgagataccgaccccaactccgggtgaaggcgaggttttgataaaagtcgcagca
acaggggtatgccactccgacctacatgtattagacggcgagatgatccccccgccagag
ggcttcatactaggacacgaggtatcggggtgggtagttgaatttgggccgaggtgcgaa
aacccccacggcctctccccaggcgaccccgttgttgtctcttggatcataccatgcggc
aagtgctactggtgcgtcagaggacaggaaaactactgcccatacgccgccgcgaggatg
ccaggccttgttgggatcaacggaggacacgcggagtacatgacagtgcctgagacggcg
atatacccaataccaaaaggactcgacgtacacaacgccgcggtcatctcgtgcgcctac
ggcactgcatacagagctttgaaagaagccggcgtcggccccggcacttcgcttgtggtt
gtaggcgccggaggcgtggggttggcggcggttgagcttgcggttgcactcggagcctac
cccattgtagctgtagacgtgagagaggctgcgctgaaaaaagcccaggaggtcggcgcc
agccatgtgataaacgccgccgagagaaacgcaattggggccataagagaagcgttgccc
caaggcactgacgtggtctacgagacgaagccaaacccagatctcaaaattgccctagaa
gttgttagaagaggggggacaatagtagtcacgggcctcggcgcgtcaacaattgagata
ccggcaatgcacctcgtaatgaatggaataagaattgtggggagcctaggctacaagcca
cgcaccgacataccagaactcctagccctagccgccgtggggaaaataaagcctgaaaaa
ataatctcacataggtataagccggaaaacatcaacgaggcctacaacaacctacgacaa
ggaaaacaccaccgcgcattaatcatctggaatccttaa

DBGET integrated database retrieval system