KEGG   Pyrobaculum arsenaticum: Pars_0489Help
Entry
Pars_0489         CDS       T00503                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00620  Pyruvate metabolism
pas00630  Glyoxylate and dicarboxylate metabolism
pas01100  Metabolic pathways
pas01110  Biosynthesis of secondary metabolites
pas01120  Microbial metabolism in diverse environments
pas01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pars_0489
   00630 Glyoxylate and dicarboxylate metabolism
    Pars_0489
Enzymes [BR:pas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pars_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABP50084
UniProt: A4WI67
Position
complement(434612..437053)
Genome map
AA seq 813 aa AA seqDB search
MIEISPSVLREYGDLFGEKTVNGRRISVEGLIEELTRELRAEIDRVIRARREWLNDKRPL
KLKAAFPSWEEKFTDADGNVRTFREIVQGLIDNLLGRDTPLRWGLNWNTPVPDDLHPLKN
PGLEITGPWSPMSRAIHQINADVASMMEDEEDASPAWYIPRGSGRTTAAVWEARRIVNRV
LRGDVPQPYYEGGKEYRIKKPREKWPTLIHRVPGLHILDFDIRVDGNPVPAIITSVVIYT
VNNYDLLKRAGSGVYFYVPKVQTPDEALVVEKLLRRVEDKLGLRRGELKIAMLYEEARAG
LYLPVIFWIWRERLVKSNNGRWDYLGSLIEMWKDEAVYPDPQNITMTHPVMMAYQKWNAL
MCLMAGLDRQGKLNAGPVGGMAAVMLYRPDDPYQRHRFNQRALRAIWLDKLRERLIGLIF
VTEEPVKKVTLRDVLEGKVKGRLFDLFRQSWVATPEESYVKAGNEPLRASLEELQQMINR
PVKFVEVDGVKIPTVDSGLTEQERQLFIRLGLLDEQGNITPWVIRPDMLDTPEKLLGNPE
LWGGKDLWTALFEPPKGDITAEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFMNDL
ATYRIFSTWLWTLLRHNAVITKDGAFKGPARTGLGVIPAEDRVKVAAGTRFTEELFDKLW
DLHMEWTLAFYEDLDRIAAERILHRFVNRVRSAVAEAYKAGPFRYQSPRDTAKKIAESIT
VEELERAVVENQPRFDRSFAPVIMEILRAKLKSPMYLQHGGRLIMALAPLPDEERDAVLR
AIFSPREEVERLVKEGKLKPYALELYDYVHDVR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgatagagattagtccttcagttctgcgcgaatatggcgacttgtttggcgagaaaacg
gtcaatggccggcggatatctgtcgaggggcttatagaggagttgacgagagaactcagg
gcggagatagacagggtaattagagccaggcgcgagtggcttaacgacaagaggcccctg
aagctaaaggcggcctttcccagctgggaagagaagttcacagacgcagacggcaacgtg
aggaccttcagggagatagtccagggccttatcgacaacctcctcggccgcgacacgccg
ttgcgctgggggcttaactggaacacgcctgtccccgacgacctccacccgcttaagaac
ccgggccttgagataacggggccgtggtcccccatgagtagggcaattcaccagataaac
gccgacgtggcgtctatgatggaggacgaggaggacgcctcgccagcctggtacatcccc
cgcggctctgggcgaaccacggctgcggtgtgggaggcccggcgtatagtaaaccgagtg
cttagaggcgatgtgccgcaaccctactacgaggggggcaaggagtacaggataaagaag
ccgagggaaaagtggcctacgctcatacacagagtgcccggcctccacatcttagacttc
gacatcagggtggacgggaaccccgtcccggccataataacctccgtggtgatatacaca
gttaataattacgaccttctaaagagggccgggtcaggggtctacttctacgtccccaag
gtccagacgccggacgaggcgctggttgtagagaagctgttgcgcagagttgaggacaaa
ctcggcttgaggcggggcgagttgaagatcgcgatgctctacgaggaggccagagccggc
ttgtacctcccggttattttctggatatggcgcgagaggttggtaaagagcaacaacggc
cgttgggactacctcggctcccttattgagatgtggaaggacgaggcggtttaccctgat
ccgcagaacatcacaatgacccaccccgtcatgatggcgtatcagaagtggaacgcactc
atgtgcctaatggcggggctagacaggcaggggaagctaaacgccggccccgtaggcggc
atggcggcggtcatgctctacaggccggacgacccgtatcagcgccaccgcttcaaccaa
agggcgctgagggccatatggcttgacaagctcagggagagactcataggcctcatcttc
gtgacggaggaacctgtgaagaaggtcacgctgagggacgtgctcgagggcaaggtcaag
gggaggctcttcgacctatttaggcagagctgggtggcgacgccggaggagtcgtatgta
aaagcaggcaacgagcctttgcgtgcgagcttggaggagctccagcagatgataaaccgc
ccagtcaagttcgtggaggtggacggcgtgaagataccgaccgtggatagcggattgaca
gagcaggaaaggcaactcttcataaggctcggcctcttagacgaacagggcaacataacc
ccctgggtgataagacccgacatgctggacacgccggagaagctcctgggcaaccccgag
ctgtggggaggcaaggacttgtggacagcgctcttcgagccgcccaagggcgacatcacg
gctgagcatatccaacacgcattctacatggccgctaactacggcttccagctcctaaac
ggcaacctcgcggcggctatcgacgactacgagctggggcaacgcttcatgaacgacttg
gcgacctaccgcatattctcgacgtggctgtggaccttgctgagacacaacgcggtcatc
acgaaagacggggcctttaagggtccagcgcgcacaggccttggagtaatccccgctgag
gatagggtgaaggtggcggcgggcacgcgcttcacggaggagctctttgacaagttgtgg
gatctccacatggagtggactcttgccttctacgaggacttggaccgcatcgcggccgag
aggatcctccacagattcgtgaatagggtgaggagcgcggtcgccgaggcttacaaggcc
ggcccgttcaggtaccagtcgccgcgagacaccgctaagaagatcgccgagtccataacg
gtggaggagctggagagggctgtggtggagaaccagccgaggttcgacaggtccttcgcc
cctgtcataatggagattctgagggcgaagctgaagtcgcctatgtatctacaacacggc
ggccgcttaatcatggccttggcgcctctgcccgacgaggagagagacgccgtattaagg
gccatcttctcgcctagagaggaggtggagaggctagtgaaggagggcaagctgaagccc
tacgcccttgagctctacgactacgttcacgatgttagataa

DBGET integrated database retrieval system