KEGG   Pyrobaculum arsenaticum: Pars_1545Help
Entry
Pars_1545         CDS       T00503                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00010  Glycolysis / Gluconeogenesis
pas00071  Fatty acid degradation
pas00350  Tyrosine metabolism
pas00625  Chloroalkane and chloroalkene degradation
pas00626  Naphthalene degradation
pas01100  Metabolic pathways
pas01110  Biosynthesis of secondary metabolites
pas01120  Microbial metabolism in diverse environments
pas01130  Biosynthesis of antibiotics
pas01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_1545
  Lipid metabolism
   00071 Fatty acid degradation
    Pars_1545
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pars_1545
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pars_1545
   00626 Naphthalene degradation
    Pars_1545
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pars_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Shikimate_DH ApbA DUF1188 Pyr_redox_2 Oxidored_nitro NAD_binding_7 AdoHcyase_NAD Pyr_redox 3HCDH_N Pyr_redox_3 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABP51099
UniProt: A4WL32
Position
complement(1400632..1401600)
Genome map
AA seq 322 aa AA seqDB search
MKAVQLVKFGEPAEALKFVDLPDPVPGPGDVVVKIEAAGVCGRDLVVRKGAFPHVKPPIV
PGHEGVGKIVDVGPGVEKDIIGERVFLSGIYDGTCEYCKRGLENLCKNAELLGESRNGTY
AEYVLVPAKFAHPFHGLDPRVAVVATCPLSTAVYALRHVDVEGKKVLVVGAGGTGIYIAQ
LAKVRGAEVYVSTRSPDKARVLKELGINTAPEGEKDFDVVVDTVGSPTLERSLKLAKRSG
SVLVIGNVTGEKALLSPALIILRQLKVIGSMAFRPWDIYEALDILKRGLVKPLYTEYKLQ
DAARAHEDMERGAVIGRAILVP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtacagcttgtcaaattcggcgaacccgcggaagcgttgaagtttgttgat
cttcccgatcctgtgccgggtcccggcgacgtggtcgtgaaaatagaggccgcgggggta
tgtgggagggacttagtggtgaggaagggcgccttcccccacgtgaagccgccgatagtt
ccaggacacgaaggcgtggggaaaatagtagatgtaggccccggcgtggagaaggatatt
atcggcgagagggtgttcctctccggtatatacgacggcacgtgcgaatactgtaagaga
gggcttgaaaatctatgtaaaaacgccgagctactaggcgagtcgcgcaacgggacatac
gccgagtatgtgctagtcccagcaaagttcgcccacccattccacggcctagatccaaga
gttgcggtcgtggccacatgcccgctgtccacagcagtgtacgcgttgagacacgtggac
gtagagggaaaaaaagtactggtagtaggcgcaggcggaacaggtatctacattgcacag
ctggctaaagtaagaggcgccgaggtctacgtctcaaccaggtcgccggacaaggcaaga
gttttgaaagagttgggtatcaacacggcgccggagggcgagaaggactttgacgtcgtg
gtggatacggtgggaagccccacactggagcgctccctcaagctggccaagagatcgggc
tctgtcttggtcatcggcaacgtaactggagaaaaggcgttgctaagccccgcgctgata
attctaagacagttgaaggtaataggcagcatggccttccggccctgggacatatacgag
gcgctggacatactgaaaagagggctagtaaagccgctctacaccgagtataagctacaa
gacgccgctagggcccatgaggatatggaaagaggagcggtcataggcagggccatcctc
gtgccttga

DBGET integrated database retrieval system