KEGG   Pyrobaculum arsenaticum: Pars_1880Help
Entry
Pars_1880         CDS       T00503                                 

Definition
(GenBank) tungsten-dependent formaldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00030  Pentose phosphate pathway
pas01100  Metabolic pathways
pas01120  Microbial metabolism in diverse environments
pas01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pars_1880
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Pars_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABP51431
UniProt: A4WM14
Position
1684175..1686001
Genome map
AA seq 608 aa AA seqDB search
MAGWTGRILRVDLTRKKAVAQELDAAVAKSFIGGRGLAIKILWDELPPGVDPLSPHNKLV
FATGPLTGLPGPNFGKLVVAAKSPLTRGYGDGNIGTWAAVNLRKAGYDALVVEGKAEKPS
YIYIENDKVEVLDATEYWGLNAWAVEEKLQKIHGRDAAVITIGPAGENLVRFATVISQKG
RSGGRPGMGAVMGSKNLKAIVVKGRGEIPLADKAAYQKLAVEAVREGSSSPSYSFWMRQG
TTSTVEWAQEASVLPTYNFSEGQFDEFSKVGGAMVEKFETDLKSCPLCFMACGHWVPAES
GTVEVDYENLAMLGPNLGIGDLSKVGELNRIADTMGMDTISLGNVLGYVMEAAERGYGEK
LGFEVEWGDYEAAKQLALDIAYRRGVGDLLAEGVKHISERIGGQDFAIHVKGLEVSAYDC
HAAPAMALAYATSPIGAHHKDAWVISWEVKTDRFGYTREKAAKVIELQRIRGGWFEAFVG
CRFPWVEVSMSLDWYPKLFKAATGVDASPEYFNEVGDRIYALIRAFWIREHGGWNREKDM
PPAKWFKNPLTRGPLKGAHLDYQGYNQLLDYYYELRGWDKNGVPTRETLSKLGLGYVAKE
LEKYVEVH
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatggacgggtagaattctccgtgtggacttaacaagaaaaaaggccgtcgcc
caggagctcgacgccgctgtggccaagtcttttatcggcggtagggggctggctattaag
atcctatgggacgagctcccgccgggtgtggatcccctgtctcctcacaataagctggta
ttcgccacgggccctctcaccgggctaccggggcctaacttcggcaagttggtagtggcg
gctaaaagccccctgacaagaggctacggagacgggaatattggaacgtgggccgccgta
aatctgagaaaggctggctacgacgcgcttgtagtagaaggcaaggccgagaagccttcc
tatatctacattgaaaacgacaaagtagaagtgctcgatgctacggagtactgggggctc
aacgcctgggctgtggaggagaagttgcagaaaatccacggcagagacgcggcggtgatc
acaattggccccgccggcgagaatttggtgcggttcgccacagtcatttcccaaaagggg
cgctcgggcggaagaccaggcatgggcgccgtgatggggtccaaaaacctaaaggcgatc
gtcgtaaagggcaggggtgagattccgctggccgataaggcggcgtaccagaagctggca
gtagaggccgtgagggagggctcctcaagccccagctacagcttctggatgcgccagggt
actacatcaactgtagaatgggcgcaagaagcaagcgtcctccccacttacaacttctcc
gagggacaattcgacgagttttcaaaagtaggcggtgccatggttgagaagttcgagaca
gacctcaagtcgtgccctctatgcttcatggcttgtggccactgggtgccagccgagtcg
gggaccgtggaggtcgactacgagaacttagccatgctcggccccaacttggggattggc
gacctatccaaggtgggggagctcaaccgcatagcggataccatgggtatggacacaatt
tccctgggcaacgtcttgggctacgtgatggaggccgcggagaggggctacggcgagaag
ctggggtttgaggtagagtggggtgactacgaggcggcgaagcaactagccctcgatata
gcctacagacggggggtaggagacttactcgcagaaggggtaaagcatatttcagagagg
ataggcggccaggacttcgccatacacgtaaaggggcttgaggtgtcggcttacgactgc
cacgccgccccggcaatggcccttgcctacgccacttcgccaatcggggcgcaccacaaa
gatgcgtgggttatctcgtgggaggtgaagacagaccgctttggctacacgcgggagaag
gccgctaaggtgatagagctacaacggattaggggcggctggttcgaggcctttgtcggt
tgccgcttcccatgggttgaggtttcgatgtcactcgactggtacccaaagcttttcaag
gccgccaccggcgtcgacgcctcgccggagtacttcaacgaggtgggggaccgcatctac
gccctcataagagccttctggattagggagcacggcgggtggaacagagagaaggacatg
ccgccggcgaagtggtttaaaaacccactgacaaggggcccactcaagggtgcccacctc
gactaccaaggctacaaccagttgttggactactactacgagctcagaggctgggacaaa
aacggggttccaacaagggagacacttagcaagctgggcctcggctacgtcgccaaggag
ttagaaaagtacgtcgaggtacactaa

DBGET integrated database retrieval system