KEGG   Pseudoalteromonas atlantica: Patl_2691
Entry
Patl_2691         CDS       T00372                                 
Name
(GenBank) transcriptional regulator, LacI family
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
pat  Pseudoalteromonas atlantica
Brite
KEGG Orthology (KO) [BR:pat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pat03000]
    Patl_2691
Transcription factors [BR:pat03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Patl_2691
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_Crp_2 Orthopox_35kD
Other DBs
NCBI-ProteinID: ABG41203
UniProt: Q15SD5
Position
3278058..3279065
AA seq 335 aa
MSNIRQVANLAGVSVATVSRALQQPERVSPKTRNKVMLAVNEVGYKPNLMAVKFRSGKTH
SLVALVPTVANVFFARVISGMQIAAAQRGYTILLANTLGDETIEANYAKMVQTSQADGLI
QLRAHNPFDASINKPNELLPMVNACEVMHDINCPVVTLDNRAAAKAMTMHLIEQGHKRIA
LIKGPQSSPLTRERLAGYGDALTEAGLKFDDSLLYPGDFTLQSGHDAATKIIASEHRPSA
VFCENDETAIGAMQCFKQAGLRIPQDISIAGFDDISFSAFCDPPLTTIAQPAEEFGQSAV
SLLIDLLEGKITKAPKVIMPFELIVRASTGPAPTL
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagtaatattaggcaagtggctaatttagcaggtgtgtcggtggcaacagtctctagg
gcattgcagcagccggagcgcgtgtcaccaaaaacgcgtaataaagttatgcttgccgta
aacgaagtgggttacaaaccgaatctgatggcggtcaagttccgctcaggtaaaacacat
agtttggtagcactggtacctacggtagcaaacgtcttttttgctcgcgtgataagtgga
atgcagatagcggccgcccagcgtggttataccattttacttgctaacacactgggcgat
gaaaccatagaggcaaactacgcaaaaatggtgcaaacctctcaggctgatgggctcatt
caattaagagcgcataatccctttgatgcatcgatcaacaagcccaacgaattactgccc
atggtcaacgcgtgcgaggtcatgcacgacattaactgccctgttgttacgttagataac
cgcgcagcggctaaagccatgacgatgcatttaattgagcaaggtcataaacgtatcgca
ctcatcaaaggccctcaatcaagcccactgacgcgcgagcgcttggcaggttatggcgat
gcgctaaccgaggcaggtttgaaatttgatgattccctgctctatccaggtgactttacc
ttgcaatccggacatgacgcagccactaaaatcattgccagtgagcaccgcccaagtgcg
gtattttgtgaaaatgacgaaaccgccattggggcaatgcagtgttttaaacaagcggga
ctgcgaattccccaagatatttccattgcggggtttgatgatatttcattttctgcattt
tgcgatcccccgctgaccactatcgctcagccagcagaagagtttggccaaagtgcggtg
tcattattgattgatttactcgaaggcaagatcaccaaagcgccaaaagtcatcatgcca
tttgaattaattgtgcgcgctagtacgggcccagcgccgacgctttag

DBGET integrated database retrieval system