KEGG   Pseudoalteromonas atlantica: Patl_0225Help
Entry
Patl_0225         CDS       T00372                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pat00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Patl_0225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pat02022]
    Patl_0225
Two-component system [BR:pat02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Patl_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: ABG38757
UniProt: Q15ZD1
Position
268013..268735
Genome map
AA seq 240 aa AA seqDB search
MGQETTKILVVDDDMRLRSLLERYLVEQGYQVRAAANAEQMDRMLERENFHLMVLDLMLP
GEDGLSICRRLRQKENEIPIVMLTAKGDEVDRIIGLEMGADDYLPKPFNPRELLARVKAV
LRRKVVEAPGAPSHAEQIVEFGKFKLNLGTREMSSEGTPMTLTSGEFAVLKSLVTHPREP
LSRDKLMNLARGRDYSALERSIDVQVSRLRRMLEEDPANPRYIQTVWGLGYVFVPDGGGA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggacaagaaaccacaaaaattttagtagtagacgatgatatgcgtttacgcagcttg
cttgaacgctatttggttgagcagggttatcaggtgcgagcggctgccaatgcagaacaa
atggatcgcatgctagaacgtgagaatttccatttgatggtacttgatttgatgttgcct
ggggaagatggcttgtctatttgccgccgcttacgtcaaaaagaaaatgaaattcctatt
gtgatgctaacggccaaaggcgatgaagttgatcgtattatcggtcttgaaatgggcgca
gatgattatttacccaagcccttcaaccctcgtgagttattggctcgggtgaaagcggtg
ttacgccgaaaagtcgttgaagcacctggtgcgccgtctcacgctgagcaaattgttgag
tttggcaagttcaaattgaatttgggcacgcgtgaaatgtcgagtgaaggtacgccaatg
acattgaccagtggcgagttcgctgtgcttaaatctttggtcactcatcctcgcgagccg
ttatcgcgggataaattaatgaacttagcgcgtggccgtgattacagtgcactcgagcgt
agcatcgacgtgcaagtatctcgtttacgccgcatgcttgaagaagaccctgcaaacccg
cgttatattcagaccgtatggggcctaggttacgtttttgtaccagacggtggtggagcc
tag

DBGET integrated database retrieval system