KEGG   Pseudoalteromonas atlantica: Patl_0451Help
Entry
Patl_0451         CDS       T00372                                 

Definition
(GenBank) short-chain alcohol dehydrogenase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00061  Fatty acid biosynthesis
pat00650  Butanoate metabolism
pat01100  Metabolic pathways
pat01120  Microbial metabolism in diverse environments
pat01200  Carbon metabolism
pat01212  Fatty acid metabolism
Module
pat_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Patl_0451
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Patl_0451
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pat01004]
    Patl_0451
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Patl_0451
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     Patl_0451
Lipid biosynthesis proteins [BR:pat01004]
 Fatty acid synthase
  Component type
   Patl_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd DUF2659
Motif
Other DBs
NCBI-ProteinID: ABG38981
UniProt: Q15YQ7
Position
524787..525968
Genome map
AA seq 393 aa AA seqDB search
MVIKPKIRGFICTNAHPEGCAASVAQQIEYVSSQGDLGSGPKNVLVIGSSTGYGLASRIV
SAFGYGANTLGVCFEKAPSERKTATAGWYNTAAFHKEAKEKGLFAQTINGDAFSKEIKAQ
AIETIKREMGQVDLVIYSLASPRRTDPETGEVYKSTLKPVGQAYTTKTYDTDKDRIHDIS
LEPANEDEIAQTIKVMGGEDWELWLDALAEADLLAYGCKTTAYTYIGKELTWPIYGQATI
GKAKEDLDRAAAAIVSKNQEKHIEAYVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGT
HEGCIEQIKGLFTERLFAQSPALDEQGRLRMDGKETNEATQAKIKALWDQVTQENFHELS
DYAGYHHEFLKLFGFDVEGVDYEKEQNTLADWD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggttattaagccaaagatccgtggctttatttgtacaaatgctcaccctgaaggttgc
gcagcaagtgttgctcaacaaatcgaatatgtctcctctcagggtgaccttggaagcgga
cctaaaaatgtattagtgattggttcttcaaccggttatgggttggcctcacgcattgtg
tcagcttttggttatggcgcgaacactctgggagtctgttttgaaaaggcgccgagtgaa
cgtaaaacggcaactgcaggttggtataatactgctgcttttcataaagaagcgaaagag
aaagggctttttgcccaaaccataaacggcgatgcgttttctaaagagataaaagcgcaa
gcaattgagaccatcaaacgtgagatgggtcaggttgatttggtgatatacagtttagcg
tctccacgtcgcacagatcccgaaacgggagaagtatataagtctaccttgaaacctgtg
ggacaagcttataccactaaaacctatgatacggacaaagaccgaatccatgacatttct
cttgaacctgccaatgaagatgaaattgcacaaacgatcaaagtcatgggcggtgaagat
tgggagttatggttagatgccttggcagaagcagatctacttgcctatggctgtaaaacc
acagcatatacctatattggcaaagagctaacttggccgatttacgggcaagcaactatt
ggcaaagcgaaagaagatttagatcgtgcagcggcagccatcgttagcaagaaccaagaa
aagcacattgaagcctatgtatcttcattgaaagcacttgttacccaagccagttcagct
attcctgttatgcctttgtatatttctcttatttataaggtgatgaaggaagagggcacg
cacgaagggtgtatcgaacaaatcaaaggcttgttcacagaacgtttatttgcacaatct
cccgcgttagatgagcaaggccgtttgcgtatggatggcaaagaaacaaatgaggctacg
caagctaagatcaaagcgttgtgggaccaagttacacaagaaaactttcatgagctaagt
gattacgccggttatcatcatgagttcttaaagcttttcggttttgatgtcgaaggtgtc
gattacgagaaagaacaaaatacgttagccgattgggattaa

DBGET integrated database retrieval system