KEGG   Pseudoalteromonas atlantica: Patl_0548Help
Entry
Patl_0548         CDS       T00372                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00790  Folate biosynthesis
pat01100  Metabolic pathways
Module
pat_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Patl_0548
Enzymes [BR:pat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Patl_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI MAPKK1_Int QueF
Motif
Other DBs
NCBI-ProteinID: ABG39077
UniProt: Q15YG1
Position
639081..639635
Genome map
AA seq 184 aa AA seqDB search
MSDDLTQHYSQILSILGEDTQRGGLVDTPKRAAKAMQFLTDGYEKNLNDVVNGAIFEADT
DEMVVIQNIEYYSLCEHHILPFIGQCHIAYLPQGKVLGLSKFARIVDMYARRLQIQEGLT
KQIADAIQEVTGAAGVGVIMEGKHMCMMMRGVQKQNSSMVTSVMLGAMRKSDATRNEFLR
LIGK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgatttaacccagcattactcgcaaattctttcgatcttaggtgaagatact
cagcgaggtggtttagtagatacgcctaaacgtgccgccaaagcgatgcagtttttgacc
gatggttacgagaaaaaccttaatgacgtagtgaatggcgctatttttgaagccgacact
gacgaaatggtcgttattcaaaatattgaatactattcactgtgcgagcaccatattttg
ccgtttattggacagtgccatattgcttatctacctcaggggaaagtgctaggactatct
aagtttgctcgcatcgttgacatgtacgcgcgtcgcctgcagatccaagagggtttaacc
aagcaaatagcggatgccattcaagaagttactggggcggctggtgtaggcgtgatcatg
gaaggcaaacatatgtgcatgatgatgcgtggtgttcaaaagcaaaactcgtccatggtg
acatcagtaatgctaggtgcgatgcgtaagtcagatgcaacacgtaatgaatttcttcgt
ttaattggtaagtaa

DBGET integrated database retrieval system