KEGG   Pseudoalteromonas atlantica: Patl_1114Help
Entry
Patl_1114         CDS       T00372                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00010  Glycolysis / Gluconeogenesis
pat00020  Citrate cycle (TCA cycle)
pat00620  Pyruvate metabolism
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
pat01130  Biosynthesis of antibiotics
pat01200  Carbon metabolism
Module
pat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Patl_1114
   00020 Citrate cycle (TCA cycle)
    Patl_1114
   00620 Pyruvate metabolism
    Patl_1114
Enzymes [BR:pat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Patl_1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 CAT
Motif
Other DBs
NCBI-ProteinID: ABG39640
UniProt: Q15WU8
Position
complement(1345397..1346794)
Genome map
AA seq 465 aa AA seqDB search
MNAPVKHISQEVLVPDIGGGTDVEIIEISVEVGYNIEVNDALIILETDKATMEVPSPIAG
IITRIFVAQGDKVSEGSVILEIEAAPEAPIQTDSAEGNTEASIEEELRSEEVGIEEEVSA
NKDDSPGSVSPRSNETTKDVHFHTSASTTNAMGISAVDKDSIAYASPSVRKLAHQLDINL
NNVTGSGPKGRITKEDTHAYVKSLMQEDRNSGDTQIAAGGPLKDMLAWPQVDFAKFGPIQ
RQPISRIRKISAANLHRNWVSIPHVTNHEDADITDLDAFRVELNQQQEKSGIKVTMVALL
IKVVTAALKKFPEFNASLDGDDIILKDYFHIGFAADTPNGLVVPVLRDADKKGILQVAKE
VSELAAKARDSKLSANDMSGGCISISSLGGIGGTYFTPIINAPEVAILGVAKARTELKWN
GKEAIPRLILPMSLSWDHRALDGAQAGRFNAYIASLLADIRRIML
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaccagtaaaacatatttcgcaagaagttctagtacccgatattggcggcggc
acagacgttgaaatcatagaaatatcagtcgaagtgggttacaacattgaggtaaatgac
gcgctgataatacttgaaaccgacaaggcaacgatggaggttccctcgccgatcgcagga
atcatcacgcgtatatttgttgcccaaggagacaaagtcagtgaaggaagtgttattctt
gaaattgaggctgctccagaagcccccattcaaactgatagcgcagaaggcaataccgaa
gctagcatcgaggaagaattacgttccgaggaagttggcattgaagaagaagtaagtgct
aataaagacgattccccagggtcagtttcacctcgcagcaacgaaaccaccaaggacgtt
cattttcatacttctgcgtcaactacgaatgccatggggataagcgcggtagataaagat
agcatcgcatacgcctccccttcagtgaggaaactagcacatcaattagacatcaacctc
aataacgtcaccgggagtggccccaaaggtcgcattactaaagaagacacccacgcctat
gtgaaatcgttaatgcaagaggatcgtaacagtggtgatacacaaattgccgctggaggt
ccgctgaaagatatgttggcatggccccaagtcgattttgctaagtttggtcccattcaa
cgccaaccgatttctcggatccgcaaaataagcgccgcaaatttacatcgcaattgggtc
agtattcctcatgtgactaatcatgaagatgcagatataactgaccttgacgcatttcgc
gttgagctcaatcagcaacaggaaaaatcagggataaaggtcaccatggttgcccttttg
ataaaggttgtcaccgctgccttgaaaaaattccctgaatttaacgccagtctcgacggt
gatgacatcatattgaaagattattttcatattggctttgcagctgatacgccaaacggt
ctcgtcgtaccggtactgcgagatgccgataagaaagggattttacaggtcgccaaagaa
gtgagtgaactggcggcaaaagccagagacagtaagctaagcgctaatgatatgagtggt
ggatgtatctctatatcttcattaggaggaataggcggtacgtatttcacccctattatt
aacgcgcctgaagtagctattttaggagtagcaaaggcgcgaactgaactcaagtggaac
ggcaaagaagcgataccaagattgatccttcccatgagtctaagttgggatcatagagcc
ttagacggtgctcaagctggacgtttcaatgcctatatagcttctctgcttgctgacatc
aggcgaataatgctctaa

DBGET integrated database retrieval system