KEGG   Pseudoalteromonas atlantica: Patl_2566Help
Entry
Patl_2566         CDS       T00372                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00900  Terpenoid backbone biosynthesis
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Patl_2566
Enzymes [BR:pat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Patl_2566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABG41082
UniProt: Q15SQ6
Position
3110925..3111785
Genome map
AA seq 286 aa AA seqDB search
MDQTIDWWPSPAKLNLFLHINGRYPNGYHQLQSLFQLLDKGDELAFTVTPHAEITLLTPI
DGVANEDNLIVKAARLLQTHTGCSEGCDIQLRKVLPMGGGIGGGSSNAATTLIALNYLWK
CNLSLTELAELGLALGADVPVFVMGNTAFAQGVGEQLTPVNIAQKHYLVVFPECHVSTAE
VFNAPDLPRNTPLISWQEYDFDQTHNDCQQLVCNRFENVANTLRWLLEYAPSRMTGTGAC
LFAVFTSNQEAENVLANLPSGCSGFVSKGVDVSPVHDKLAHLGSIS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaacaatagattggtggccaagccccgccaaattgaacctgtttttacacatc
aatggccgttaccccaacggctatcatcaattgcaaagcctatttcaactattggataaa
ggcgatgaattggcttttacggttacgccccatgctgaaattacattgctcacgccaata
gacggggtagcaaatgaagacaaccttatcgttaaggcggcacgtttattacaaacacat
acgggctgctccgaaggttgcgacatccaattacgtaaagtgttgcccatggggggggga
attggaggaggctcgtctaatgcggcgaccacattaattgcccttaactatttatggaaa
tgtaatctaagcctgacagaattggcggaattaggcctagcgttaggtgctgatgtgccg
gtttttgtcatgggcaataccgcttttgctcagggtgttggcgagcagctaacgcctgta
aatattgcgcagaagcactacctggttgtgtttcctgaatgtcacgtgtctaccgctgag
gtatttaacgcccctgatttgcccagaaatacaccacttatttcttggcaagagtatgat
tttgaccaaacacataacgactgccagcaattagtctgtaatcgctttgagaatgttgca
aatacattacgctggttgttagaatacgcgccgtctcgaatgacaggcacaggtgcttgt
ttatttgcggtctttaccagtaaccaagaagcagaaaatgtacttgctaatttaccatca
ggttgctcaggttttgtctccaaaggagtcgatgtgtctcccgtgcacgacaaattagcg
cacctaggtagcattagctag

DBGET integrated database retrieval system