KEGG   Pseudoalteromonas atlantica: Patl_2923Help
Entry
Patl_2923         CDS       T00372                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00071  Fatty acid degradation
pat00072  Synthesis and degradation of ketone bodies
pat00280  Valine, leucine and isoleucine degradation
pat00310  Lysine degradation
pat00362  Benzoate degradation
pat00380  Tryptophan metabolism
pat00620  Pyruvate metabolism
pat00630  Glyoxylate and dicarboxylate metabolism
pat00640  Propanoate metabolism
pat00650  Butanoate metabolism
pat00900  Terpenoid backbone biosynthesis
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
pat01130  Biosynthesis of antibiotics
pat01200  Carbon metabolism
pat01212  Fatty acid metabolism
pat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Patl_2923
   00630 Glyoxylate and dicarboxylate metabolism
    Patl_2923
   00640 Propanoate metabolism
    Patl_2923
   00650 Butanoate metabolism
    Patl_2923
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Patl_2923
   00072 Synthesis and degradation of ketone bodies
    Patl_2923
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Patl_2923
   00310 Lysine degradation
    Patl_2923
   00380 Tryptophan metabolism
    Patl_2923
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Patl_2923
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Patl_2923
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Patl_2923
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pat04147]
    Patl_2923
Enzymes [BR:pat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Patl_2923
Exosome [BR:pat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Patl_2923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABG41431
UniProt: Q15RQ7
Position
complement(3544078..3545262)
Genome map
AA seq 394 aa AA seqDB search
MSNSSVVIVSAKRTPMGGFMGGLSALSACELGANVITAALTDAGDDAPVVDEVIMGCVLP
AGLGQAPARQASIKAGLPLGTGAITLNKVCGSGMKAVMLAHDLIKSGSAKTVVAGGMESM
SNAPYILPKARQGYRMGHGHMLDHMMLDGLENAYDGKAMGCFAQSKADEEHVTREQMDEF
ALGSLTKASDAIANGLFKDEITPVKITSRKGEVVIENDEGPGNARPEKIPSLRPAFTKDG
TVTAANSSSISDGAAALLVMSEEEAKAKGYTPLARIVGHSSNAIEPENFTVAPVGAMEKL
FAKTGWSKEDVDLFEINEAFAMVTMLGMRKLGLDPAKVNVKGGACALGHPIGASGARIIV
TLLHALKQRSLKKGVAAICIGGGEATAIAFEMLV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacagttcagtagtgattgttagtgctaaacgtacaccaatgggtgggtttatg
gggggcttgtcagcactgagtgcctgcgagttaggtgcaaatgtgattacagcggcatta
acagatgcgggtgatgatgcacctgttgttgatgaagtcattatgggctgtgttttacct
gctggattagggcaagcgccggctcgtcaagcgagtataaaagcgggtttgccacttggt
actggtgcgataacgttaaataaggtgtgcggttcaggtatgaaggcagtgatgcttgcc
catgatttgattaagtctggtagtgctaagacggttgtggcgggtggtatggagagtatg
tccaatgcgccgtatatcttacccaaagcgaggcaggggtatcgcatggggcatggacat
atgttggaccatatgatgctggacggtttggaaaacgcctatgacggtaaagcgatgggc
tgctttgctcagtctaaagctgacgaagagcatgtgactcgagagcaaatggatgagttc
gcattaggctcgctaactaaggccagtgacgcgatagctaatgggttgtttaaagacgaa
attacaccggtgaaaatcacttctcgcaaaggtgaggtcgtcattgaaaacgatgaaggg
ccaggaaacgctcgccctgagaagatcccttctttgcgccccgcattcacgaaagacggt
acggtcacggcggcgaattctagctctatttcagatggtgctgctgcgttgttggtcatg
agcgaagaagaagcaaaagcaaaagggtacacaccgttagcacgtattgttgggcatagc
tcaaatgctattgagcccgagaatttcacagtggcacctgttggtgctatggaaaaactg
ttcgcgaaaacgggttggtcaaaagaagatgtagacttatttgagatcaacgaagccttt
gccatggtcactatgttgggtatgcgtaaacttggtctagatcccgctaaagtaaacgtg
aaaggtggagcatgtgcccttggtcacccgattggggcctcaggcgcgcgtattatcgtg
actttactgcatgcacttaagcagcgtagcctgaaaaaaggcgtagctgctatttgtatc
ggcggtggtgaagcgaccgcgatagcgtttgaaatgctagtttaa

DBGET integrated database retrieval system