KEGG   Pseudoalteromonas atlantica: Patl_2970Help
Entry
Patl_2970         CDS       T00372                                 

Definition
(GenBank) electron transport complex, RnfABCDGE type, E subunit
  KO
K03613  Na+-translocating ferredoxin:NAD+ oxidoreductase subunit E
Organism
pat  Pseudoalteromonas atlantica
Brite
KEGG Orthology (KO) [BR:pat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Patl_2970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rnf-Nqr
Motif
Other DBs
NCBI-ProteinID: ABG41478
UniProt: Q15RL0
Position
3597199..3597897
Genome map
AA seq 232 aa AA seqDB search
MNEFKQLSWQGLWKNNPALVQLLGLCPLLAVTATVTNGLGLGLATTLVLIGSNATVSIIR
NLVPNEIRIPIFVMIIAAFVTVVQLLMNAYTYELYQALGIFIPLIVTNCAIIGRAEAYAS
KNPIGYAAFDGLMMGLGFTVVLVLLGAMRELLGYGTLFAGANLLLGDWATSLKVTIFTTD
SPFLLAILPPGAFLGMGLLIAAKNILDKRFERMFAAKQEAKVVQRARVTAET
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattcaaacagttaagttggcaaggcctgtggaagaataacccggccctagta
caactacttggtttgtgcccgctacttgccgttactgcgaccgttaccaacggtctaggc
ctaggcttagccacgaccttggtcttgattggctcaaatgcgaccgtatcgattattcgt
aacctagtgccaaatgaaatccgaattcctattttcgtcatgattattgccgcgtttgtc
actgtcgtgcagcttttaatgaatgcctacacgtacgagttgtatcaggcgcttggtata
ttcattccccttattgtgaccaactgtgcaattatcggccgagctgaagcttacgcttct
aaaaaccctattggctatgccgcattcgacgggttgatgatggggctcgggtttaccgtg
gtgctcgtgcttttgggggcaatgcgtgaactgcttggctacggtactttatttgccgga
gctaacctgctgttaggcgattgggcaaccagtttaaaagtgacaattttcactacagat
tcccccttcttacttgccattttacctccaggggcattcttaggtatgggcttgctgatc
gccgctaagaacatacttgataagcgttttgaacgtatgtttgcagccaaacaagaagcc
aaagtcgttcagcgtgctcgtgtcactgccgaaacctaa

DBGET integrated database retrieval system