KEGG   Pectobacterium atrosepticum 21A: GZ59_13080Help
Entry
GZ59_13080        CDS       T03293                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
pato00071  Fatty acid degradation
pato00280  Valine, leucine and isoleucine degradation
pato00310  Lysine degradation
pato00362  Benzoate degradation
pato00380  Tryptophan metabolism
pato00620  Pyruvate metabolism
pato00630  Glyoxylate and dicarboxylate metabolism
pato00640  Propanoate metabolism
pato00650  Butanoate metabolism
pato00900  Terpenoid backbone biosynthesis
pato01100  Metabolic pathways
pato01110  Biosynthesis of secondary metabolites
pato01120  Microbial metabolism in diverse environments
pato01130  Biosynthesis of antibiotics
pato01200  Carbon metabolism
pato01212  Fatty acid metabolism
pato02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pato00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GZ59_13080 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    GZ59_13080 (atoB)
   00640 Propanoate metabolism
    GZ59_13080 (atoB)
   00650 Butanoate metabolism
    GZ59_13080 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GZ59_13080 (atoB)
   00072 Synthesis and degradation of ketone bodies
    GZ59_13080 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GZ59_13080 (atoB)
   00310 Lysine degradation
    GZ59_13080 (atoB)
   00380 Tryptophan metabolism
    GZ59_13080 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GZ59_13080 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GZ59_13080 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GZ59_13080 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pato04147]
    GZ59_13080 (atoB)
Enzymes [BR:pato01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GZ59_13080 (atoB)
Exosome [BR:pato04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GZ59_13080 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIK13157
Position
complement(1438424..1439602)
Genome map
AA seq 392 aa AA seqDB search
MNDSIVIVNAKRTAIGKFAGSLANTSAIDMASATIRDCLSTLPDTLAIDEVILGNVLQAG
LGQNPAHQASKAAGLPFETPSLTISKVCGSGLKAVVMGAQSILSGDNQVCVTGGMENMSA
APYLLEKARHGYRMGDGKLVDIMIKDGLWCAFNDYHMGTTAENIAERYQLTREEQDQVAL
ASQQKAVAAIEAGRFKAEITPLSLRSKKETRIFDRDEFPRADTTLASLAALRPAFSANGT
VTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKAL
LKAGLTIGDIDLIEANEAFAAQFLAVQRDLHLDPEKVNVNGGAIALGHPIGASGARILVT
LVHALHSYNKTLGLATLCIGGGQGIAMIVERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccattgttattgttaatgccaagcgcaccgcgattggtaaattcgcaggc
agtctggccaacacatcggctatcgacatggcatctgccaccatccgtgactgcctgtcg
acgctgccggacacgctggcgattgatgaagtgattctcggcaacgtgctgcaagccggt
ctggggcaaaaccccgcgcatcaggccagcaaggctgctgggctgccttttgaaacaccc
tcgctcaccatcagtaaggtgtgtggttccggcctgaaggccgttgtgatgggcgcacag
tctattctgtccggcgataatcaggtctgcgtgaccggcgggatggaaaacatgagcgcc
gcgccttacctgctggaaaaagcgcgccacggttaccgcatgggagacggcaagctcgtt
gacatcatgattaaggatggtctgtggtgtgcgtttaacgattaccacatgggtaccacg
gcggaaaatatcgccgagcgctaccagctcacgcgagaagaacaggatcaggtggcgctg
gcatcacagcagaaagccgtcgccgcgattgaggctggccgcttcaaagccgaaataacc
ccgctgtcactgcgtagcaaaaaagagacgcggattttcgatcgggatgaattccctcgc
gccgacaccacgctggcatcgctggccgcgttacgtccggcgttttccgctaacggcacc
gtcaccgcaggcaatgcgtccggcattaacgatgccgccgcgacgctggtgttaatgcgt
gaatccgaagcgaaaaaacagggtattaccccgctggcgcggatccgcagttgggcgtct
gctggagtaccgagtgaagtgatggggctggggccgattccggcgacgcagaaagcactg
ctcaaggctgggctgacgatcggtgatattgacctgattgaagcaaatgaagcttttgcc
gcacagtttctagcggtacagcgcgatcttcatctcgatccagagaaagtgaacgtcaac
ggcggtgcgattgcgttgggccaccctatcggcgcgagcggtgcgcgtattctcgtcacg
ctggtacatgcgctgcacagctataacaaaacgctgggattggcgacgctgtgcatcggc
ggtgggcaaggtatcgcgatgatcgtcgaacgcgtttaa

DBGET integrated database retrieval system