KEGG   Pectobacterium atrosepticum 21A: GZ59_38590Help
Entry
GZ59_38590        CDS       T03293                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pato  Pectobacterium atrosepticum 21A
Brite
KEGG Orthology (KO) [BR:pato00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GZ59_38590 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIK15576
Position
4191036..4191413
Genome map
AA seq 125 aa AA seqDB search
MINAPRVCVQIQSFYVESQSEPDEERFVFAYTVTVRNLGRHEVQLLGRYWLITNGNGRQT
EVQGEGVVGEQPIIEPGGEFQYTSGAVMETPLGTMEGHYHMVDHQSKAFQVPIPVFRLAI
PSLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgcgccccgtgtttgtgtacaaattcagagcttctatgtggaatcacaatca
gagcctgatgaagaacgtttcgtgtttgcttacacggttacggttcgcaatctggggcgt
catgaagtccagcttttggggcgttattggctgatcaccaacggtaatggccgtcagact
gaagttcagggtgaaggcgtagtcggtgaacagccgattatcgagcctggcggcgagttc
caatataccagcggtgcagtcatggaaacgcccctcggcacaatggaaggccactaccat
atggttgaccatcagagtaaagcgtttcaggtcccaatccccgtcttccgactggcaatc
ccctcactgatacattaa

DBGET integrated database retrieval system