KEGG   Pectobacterium atrosepticum JG10-08: EV46_06450Help
Entry
EV46_06450        CDS       T03199                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
patr  Pectobacterium atrosepticum JG10-08
Pathway
patr00071  Fatty acid degradation
patr00280  Valine, leucine and isoleucine degradation
patr00310  Lysine degradation
patr00362  Benzoate degradation
patr00380  Tryptophan metabolism
patr00620  Pyruvate metabolism
patr00630  Glyoxylate and dicarboxylate metabolism
patr00640  Propanoate metabolism
patr00650  Butanoate metabolism
patr00900  Terpenoid backbone biosynthesis
patr01100  Metabolic pathways
patr01110  Biosynthesis of secondary metabolites
patr01120  Microbial metabolism in diverse environments
patr01130  Biosynthesis of antibiotics
patr01200  Carbon metabolism
patr01212  Fatty acid metabolism
patr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:patr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EV46_06450
   00630 Glyoxylate and dicarboxylate metabolism
    EV46_06450
   00640 Propanoate metabolism
    EV46_06450
   00650 Butanoate metabolism
    EV46_06450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EV46_06450
   00072 Synthesis and degradation of ketone bodies
    EV46_06450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EV46_06450
   00310 Lysine degradation
    EV46_06450
   00380 Tryptophan metabolism
    EV46_06450
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EV46_06450
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EV46_06450
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EV46_06450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:patr04147]
    EV46_06450
Enzymes [BR:patr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EV46_06450
Exosome [BR:patr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EV46_06450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIA70238
Position
complement(1443411..1444589)
Genome map
AA seq 392 aa AA seqDB search
MNDSIVIVNAKRTAIGKFAGSLANTSAIDMASATIRDCLSTLPDTLAIDEVILGNVLQAG
LGQNPAHQASKAAGLPFETPSLTISKVCGSGLKAVVMGAQSILSGDNQVCVTGGMENMSA
APYLLEKARHGYRMGDGKLVDIMIKDGLWCAFNDYHMGTTAENIAERYQLTREEQDQVAL
ASQQKAVAAIEAGRFKAEITPLSLRSKKETRIFDRDEFPRADTTLASLAALRPAFSANGT
VTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKAL
LKAGLTIGDIDLIEANEAFAAQFLAVQRDLHLDPEKVNVNGGAIALGHPIGASGARILVT
LVHALHSYNKTLGLATLCIGGGQGIAMIVERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccattgttattgttaatgccaagcgcaccgcgattggtaaattcgcaggc
agtctggccaacacatcggctatcgacatggcatctgccaccatccgtgactgcctgtcg
acgctgccggacacgctggcgattgatgaagtgattctcggcaacgtgctgcaagccggt
ctggggcaaaaccccgcgcatcaggccagcaaggctgctgggctgccttttgaaacaccc
tcgctcaccatcagtaaggtgtgtggttccggcctgaaggccgttgtgatgggcgcacag
tctattctgtccggcgataatcaggtctgcgtgaccggcgggatggaaaacatgagcgcc
gcgccttacctgctggaaaaagcgcgccacggttaccgcatgggagacggcaagctcgtt
gacatcatgattaaggatggtctgtggtgtgcgtttaacgattaccacatgggtaccacg
gcggaaaatatcgccgagcgctaccagctcacgcgagaagaacaggatcaggtggcgctg
gcatcacagcagaaagccgtcgccgcgattgaggctggccgcttcaaagccgaaataacc
ccgctgtcactgcgtagcaaaaaagagacgcggattttcgatcgggatgaattccctcgc
gccgacaccacgctggcatcgctggccgcgttacgtccggcgttttccgctaacggcacc
gtcaccgcaggcaatgcgtccggcattaacgatgccgccgcgacgctggtgttaatgcgt
gaatccgaagcgaaaaaacagggtattaccccgctggcgcggatccgcagttgggcgtct
gctggagtaccgagtgaagtgatggggctggggccgattccggcgacgcagaaagcactg
ctcaaggctgggctgacgatcggtgatattgacctgattgaagcaaatgaagcttttgcc
gcacagtttctagcggtacagcgcgatcttcatctcgatccagagaaagtgaacgtcaac
ggcggtgcgattgcgttgggccaccctatcggcgcgagcggtgcgcgtattctcgtcacg
ctggtacatgcgctgcacagctataacaaaacgctgggattggcgacgctgtgcatcggc
ggtgggcaaggtatcgcgatgatcgtcgaacgcgtttaa

DBGET integrated database retrieval system