KEGG   Pectobacterium atrosepticum JG10-08: EV46_15485Help
Entry
EV46_15485        CDS       T03199                                 

Definition
(GenBank) AMP-dependent synthetase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
patr  Pectobacterium atrosepticum JG10-08
Pathway
patr00473  D-Alanine metabolism
patr01100  Metabolic pathways
patr01503  Cationic antimicrobial peptide (CAMP) resistance
patr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:patr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EV46_15485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EV46_15485
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EV46_15485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:patr01504]
    EV46_15485
Enzymes [BR:patr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     EV46_15485
Antimicrobial resistance genes [BR:patr01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    EV46_15485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AIA71951
Position
complement(3463643..3465076)
Genome map
AA seq 477 aa AA seqDB search
MNLHSELQELQDFLRAALLQPANPNQLAISGSDDAMTWQQLSVAVTDWSHRYQQCQRPAG
SPVVLYGHQQAEFAVAIYSCLLHNIPYIPVDCIYPQERLKEICHLANAPYYYDVATRQFI
ATGEAGQALVEQNLAYIMFTSGSTGKPKGVQIGRESLWHFMKWVREDFSLPDAPVLMNHA
VFSFDLSLIPLLANLATGGHIVLNAKEDIAAENWLDRLKDNGVSVWVSTPSFAYQKLLSP
QFNSEYLPELNVFVFIGEVLNKALVKQLRRRFPHAKILNSYGPTEATIATTVIEITDDIL
HSENDLLPVGAMMPDSRMEITAEGELIIWGKNVMRGYLGLAQENAEKLLHRESEAFRGYR
TGDLGYENGLLYCQGRNDSQIKLNGYRIEINEIENRLLAISDISEAVVLPLMKSGGGVLR
IAAFCVTSLAPEVIKTSLSKVIPPYMVPSQIIIKDALPLNPNGKIDRKLLDTHARTI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcattcagagcttcaggaactgcaagatttccttcgtgcggcattacttcaa
cccgctaacccaaatcagttggcgattagcggtagcgatgacgcgatgacctggcaacag
ctatccgttgccgttacagactggtcgcatcgctatcagcaatgccagcggcccgcaggt
tcacccgtcgtattatatgggcatcagcaggcggagtttgccgtggcgatctatagctgc
ctgctgcataacattccgtatatcccggtggactgcatctatccgcaggagcggcttaag
gagatttgccacctggcgaacgccccttactactacgatgtcgcgacccggcagttcatt
gctaccggtgaggctggtcaggcactggtcgagcagaatctcgcctatatcatgttcacc
tccggcagcaccggaaaacccaagggtgtgcagatcgggcgtgaaagcctgtggcatttc
atgaagtgggtgcgtgaggatttctcgctgccagacgcgccagtgctgatgaaccatgcg
gtgttcagtttcgatctctccctgatcccgctgctggcgaatcttgccactggggggcac
atcgttctgaatgcgaaagaggatattgcggcagaaaactggctcgatcgcctaaaagac
aatggcgtttctgtctgggtttcaacgccatcttttgcctatcagaaactgctctctcct
cagttcaacagtgaatatttacctgaactcaacgtcttcgtgttcatcggtgaagtgcta
aacaaagcgctggtcaaacagttacgccgccgcttcccgcacgccaaaattctcaactcc
tatggcccaacggaagcgactatcgccaccaccgtcatcgaaatcaccgatgacatcctg
catagcgaaaacgatctgctgccggttggcgcgatgatgccggattccagaatggaaatt
accgctgagggtgagctgattatttggggcaaaaatgtgatgcgcggctaccttgggctc
gcgcaggagaacgctgagaaattgttgcatcgggaaagtgaagcgttccgaggctacaga
accggcgacctgggctatgagaacgggctcctttactgtcagggccgcaatgacagccag
atcaaactcaatggctaccgcattgaaatcaacgagattgaaaatcgcctgctggcgata
tccgacatcagcgaagcggttgtcctgccgctgatgaaatcgggcggtggcgtgctgcgt
attgcggcattctgcgtgacgagcttagcacccgaagtgattaaaacctcgctctctaag
gtgattccgccttacatggtgccttcccaaatcattatcaaagatgcgttgccgctgaat
cctaacggcaaaattgatcgtaaactgctggatacccatgcccgcacgatttaa

DBGET integrated database retrieval system