KEGG   Pectobacterium atrosepticum JG10-08: EV46_18930Help
Entry
EV46_18930        CDS       T03199                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
patr  Pectobacterium atrosepticum JG10-08
Brite
KEGG Orthology (KO) [BR:patr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EV46_18930 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIA72596
Position
4236634..4237011
Genome map
AA seq 125 aa AA seqDB search
MINAPRVCVQIQSFYVESQSEPDEERFVFAYTVTVRNLGRHEVQLLGRYWLITNGNGRQT
EVQGEGVVGEQPIIEPGGEFQYTSGAVMETPLGTMEGHYHMVDHQSKAFQVPIPVFRLAI
PSLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgcgccccgtgtttgtgtacaaattcagagcttctatgtggaatcacaatca
gagcctgatgaagaacgtttcgtgtttgcttacacggttacggttcgcaatctggggcgt
catgaagtccagcttttggggcgttattggctgatcaccaacggtaatggccgtcagact
gaagttcagggtgaaggcgtagtcggtgaacagccgattatcgagcctggcggcgagttc
caatataccagcggtgcagtcatggaaacgcccctcggcacaatggaaggccactaccat
atggttgaccatcagagtaaagcgtttcaggtcccaatccccgtcttccgactggcaatc
ccctcactgatacattaa

DBGET integrated database retrieval system