KEGG   Pectobacterium atrosepticum JG10-08: EV46_20430Help
Entry
EV46_20430        CDS       T03199                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
patr  Pectobacterium atrosepticum JG10-08
Pathway
patr00010  Glycolysis / Gluconeogenesis
patr00020  Citrate cycle (TCA cycle)
patr00620  Pyruvate metabolism
patr01100  Metabolic pathways
patr01110  Biosynthesis of secondary metabolites
patr01120  Microbial metabolism in diverse environments
patr01130  Biosynthesis of antibiotics
patr01200  Carbon metabolism
Module
patr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:patr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EV46_20430
   00020 Citrate cycle (TCA cycle)
    EV46_20430
   00620 Pyruvate metabolism
    EV46_20430
Enzymes [BR:patr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     EV46_20430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AIA72880
Position
4526619..4528238
Genome map
AA seq 539 aa AA seqDB search
MQINGITPQALAAYGIHDVRDIVYNPSYELLFKEERSPTLQGYERGIETQLGAVAVDTGI
FTGRSPKDKYIVRDDVTRDTVWWSDQGKGKNDNHPLSQETWTHLKELVTTQLSGKRLFII
DAFCGANPDSRLSVRFVTEVAWQAHFVKNMFIRPSDEELEGFEPDFIVMNGAKCTNPNWQ
EQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSIMNYLLPLKGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPDIF
GAIKRDALLENVTVLADGAVDFNDGSKTENTRVSYPIYHIHNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTSDQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLMLHPTQY
AEVLVKRMKASGAQAYLVNTGWNGSGKRISIKDTRGIIDAILNGSIDDAEMQTLPVFDLA
IPTSLPGVNPDILDPRDTYASIEQWQEKADDLAQRFITNFDKYTDAPAGAALVKAGPKR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaacggtattaccccgcaagccctagctgcttatggaatccatgatgtccgc
gatattgtctacaatcccagctatgaactgctttttaaagaagaacgttcccctacccta
caaggctatgaacgcggcatcgaaacccaactgggtgcagtagccgtcgatactggcatc
tttaccggccgttccccgaaagacaaatacatcgtgcgcgatgacgttacccgcgacacc
gtgtggtggtccgatcaaggcaaaggtaagaatgataaccacccattgagtcaggaaacc
tggacgcacctgaaagaactcgtcaccacgcaactgtccggcaagcggttgttcatcatc
gatgctttctgtggcgccaatccagacagccgcctcagcgtgcgtttcgtgacggaagta
gcctggcaggcgcatttcgtcaaaaacatgtttatccgtccgagcgatgaagaactggaa
ggttttgaaccggatttcatcgtgatgaacggtgcaaaatgcactaatccgaactggcag
gaacaggggctaaactctgagaactttgtcgcgttcaacctgacggaacgcatccagctg
attggcggcacctggtacggtggcgaaatgaagaaagggatgttctccatcatgaactac
ctgctgccgttaaaaggcatcgcctcgatgcactgctcggcaaacgtcggcgaaaaaggc
gatgtggcggtcttcttcggcctgtccggtacgggtaaaaccacgctctctaccgatccg
aaacgccaattgattggcgatgacgaacacggctgggacgacgatggcgtcttcaacttt
gaaggcggctgctacgccaaaaccatcaagctgtccaaagaagcagagccggatatcttc
ggtgccatcaaacgcgatgcgctgctggaaaacgtcaccgtgctggcagacggcgcagtg
gacttcaacgacggttccaaaacggagaatacccgcgtctcttacccgatctaccatatc
cacaatattgttaaaccggtctccaaagcaggtcacgcgaccaaagtgatcttcctgacg
gcggacgcgttcggcgtgttgccacctgtttctcgcctgacatccgatcagacgcagtat
cacttcctgtccggctttaccgccaaactggcgggaactgagcgcggcgtgacggagccg
acaccaaccttctccgcctgctttggcgcggcattcctaatgctgcacccaacgcagtac
gctgaagtgctggtgaaacgaatgaaagcatcaggcgcgcaggcctatctggtgaatacc
ggctggaacggcagcggcaaacgtatctcaatcaaggatacgcgagggattattgacgcc
attctgaatggcagcattgatgatgcagaaatgcagacactgccggtcttcgatttggcg
atcccgacctcgctgcccggcgtcaatcctgacattctcgatccacgtgatacctacgcg
agcatcgaacagtggcaggaaaaagcggacgatctggcccaacgctttatcaccaacttc
gataaatacaccgatgcaccagcaggtgccgcgctggtgaaagcaggaccgaagcggtaa

DBGET integrated database retrieval system