KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_08280
Entry
PA14_08280        CDS       T00401                                 
Name
(GenBank) putative phage tail assembly protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB
Motif
Pfam: Lambda_tail_I
Other DBs
NCBI-ProteinID: ABJ15605
UniProt: A0A0H2ZLF4
Position
707111..707713
AA seq 200 aa
MNDTLSQGLTTIRLYGVLGKRFGRMHGRLLESGTVREAMSALKHTMEGFETFMREAESKG
LTFAVFRGRTNLSGEQLDMRGREDIRIVPLVIGSKQSGLFQTVLGAALIAVGVFATSLTL
GTSTFLISAGASMMLGGVMQMLSPQPKGLKGREAPENAPSYAFGGPVNTIAQGHPVGVLY
GKRRIGGAVISAGIYAEDRL
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaatgacaccctgagtcagggcctcaccaccatccgtctgtacggggttctgggcaag
cgcttcggccgcatgcacggccggttgttggaaagcggcacggtacgcgaggcgatgagc
gccctgaagcacaccatggagggattcgagacgttcatgcgcgaggcggaatcgaaaggg
ctgaccttcgccgtgttccgtgggcgtaccaacctgtccggcgagcaactggacatgcgc
ggacgcgaggatatccgcatcgtgccgttggtgatcgggagcaagcagtccggattgttt
cagacggtattaggagctgcactcattgccgtaggtgtcttcgcaacgagtcttacgctc
gggacaagcacgtttctgatctctgccggcgccagcatgatgctcggtggcgtcatgcag
atgctcagcccccaacccaagggcctgaagggccgagaggcccccgagaacgcccccagc
tatgccttcggcggcccggtcaacaccatcgcccagggccatccggtcggcgtgctctac
ggcaagcgccgcatcggcggcgcggtgatcagcgccggcatctatgccgaggaccggctg
tag

DBGET integrated database retrieval system