KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_00360
Entry
PA14_00360        CDS       T00401                                 

Definition
(GenBank) putative glycine betaine/L-proline ABC transporter, periplasmic substrate-binding protein
  KO
K02002  glycine betaine/proline transport system substrate-binding protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PA14_00360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pau02000]
    PA14_00360
Transporters [BR:pau02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    PA14_00360
SSDB
Motif
Pfam: OpuAC
Other DBs
NCBI-ProteinID: ABJ14986
UniProt: A0A0H2ZJZ0
Position
complement(32081..33004)
AA seq 307 aa
MNRLPTCLLAATLFLGSASLYAEDPACARVRLADPGWSDIAVTNATAAFLLESLGYQVKI
DTLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHDKFVASGQVERLARNLDGTRFTLAVPRY
VWDAGVHRFEDLAAQGQRFNRKLYGIGSGAPANQSIQKMIDANQFGLGDWKLVESSEQAM
LAELGRAEKRQRWLVFLGWTPHPMNIRHDLRYLEGGEQYFGDRGQVYTLARKGYAAQCPN
PARLLANLRFDLDMENRLMSDALEGTATPASATRAWLKANPRVLEAWLQGVTSRDGGDAL
AAVRGQP
NT seq 924 nt   +upstreamnt  +downstreamnt
atgaaccggcttcccacctgcctgctggccgccaccctgttcctgggcagcgcctcgcta
tacgccgaagaccccgcctgtgcccgcgtcaggctggccgatccaggctggagcgatatc
gcggtgaccaacgccaccgccgcgtttctcctggaaagcctcggctaccaggtgaagatc
gataccctgtcggtgccgatcatctatggcggcctgcgcgacggccaggtggacgccttc
ctcggcggctggatgcccgcgcaccaggactatcacgacaagttcgtcgccagcggccag
gtcgaacgcctcgctcgcaacctcgatggcacccgcttcaccctggcggtgccgcgctac
gtctgggacgccggcgtacaccgcttcgaagacctcgccgcgcaagggcaacgcttcaac
cgcaagctgtacgggatcggctccggcgcgccggccaatcagtcgatccagaagatgatc
gacgccaaccagttcggcctcggcgactggaagctggtggagtccagcgagcaggcgatg
ctcgccgaactcggccgggccgagaagcgccagcgctggctggtgttcctcggctggacg
ccgcacccgatgaacatccgccatgacctgcgctacctggaaggcggcgagcagtacttc
ggcgaccgcggccaggtctataccctggcacgcaagggctacgccgcgcagtgcccgaac
ccggcgcggctgctggccaacctgcgcttcgacctggacatggagaaccgcctgatgagc
gacgcgctggaaggcacggcgactccggcctcggcgacccgcgcctggctcaaggccaac
ccgcgggtgctcgaggcctggctgcaaggggtgaccagccgcgacggcggcgacgccctg
gccgcggttcgcggccagccatag

DBGET integrated database retrieval system