KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_00440
Entry
PA14_00440        CDS       T00401                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00260  Glycine, serine and threonine metabolism
pau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01230  Biosynthesis of amino acids
Module
pau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PA14_00440 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PA14_00440 (trpA)
Enzymes [BR:pau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PA14_00440 (trpA)
SSDB
Motif
Pfam: Trp_syntA PcrB His_biosynth
Other DBs
NCBI-ProteinID: ABJ14992
UniProt: Q02V45
Position
complement(37108..37914)
AA seq 268 aa
MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALDGGQTLARTLQMVREFRSGDSETPLVLMGYFNPIHHYGVERFIAEAKE
VGVDGLIVVDLPPEHNEDLCHPAQAAGLDFIRLTTPTTGDQRLPTVLEGSSGFVYYVSVA
GVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAAVARLADGVVVGSALIDRI
AKARDNAQAVKDVLALCGELAEGVRNAR
NT seq 807 nt   +upstreamnt  +downstreamnt
atgagccgcctgcagacccgcttcgcccagctcaagcaggaaaaccgcgccgccctggtg
accttcgtcaccgccggcgacccggactacgcgtcttccctggaaatcctcaaaggcctg
ccggcggccggagccgacgtgatcgaactgggcatgccgttcaccgatccgatggcggac
ggcccggccatccagttggccaacatccgcgccctcgacggcggccagaccctggccagg
acgttgcagatggtccgcgaattccgcagcggcgacagcgagacacccctggtgctgatg
ggctacttcaacccgatccaccactacggcgtcgagcgcttcatcgccgaggcgaaggag
gtgggggtggacggcctgatcgtggtcgacctgccgccggagcacaacgaagacctctgc
cacccggcccaggccgccggcctcgacttcatccgcctgaccaccccgaccaccggcgac
cagcgcctgccgacggtgctcgaaggcagttccgggtttgtctactacgtgtcggtggcc
ggcgtcaccggcgccaacgcggcgaccctggaacacgtcgaggaagcggtggcgcgcctg
cgccggcataccgacttgccgatcggtatcggcttcggcatccgcagcgccgaacacgcc
gccgcggtcgcgcggttggccgacggcgtggtggtcggctcggcgctgatcgaccggatc
gccaaggcccgcgacaatgcccaggcggtcaaggatgtcctcgccctgtgcggcgagctg
gccgaaggcgtgcgcaacgcacgctga

DBGET integrated database retrieval system