KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_00440Help
Entry
PA14_00440        CDS       T00401                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00260  Glycine, serine and threonine metabolism
pau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01130  Biosynthesis of antibiotics
pau01230  Biosynthesis of amino acids
Module
pau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PA14_00440 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PA14_00440 (trpA)
Enzymes [BR:pau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PA14_00440 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABJ14992
UniProt: Q02V45
Position
complement(37108..37914)
Genome map
AA seq 268 aa AA seqDB search
MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALDGGQTLARTLQMVREFRSGDSETPLVLMGYFNPIHHYGVERFIAEAKE
VGVDGLIVVDLPPEHNEDLCHPAQAAGLDFIRLTTPTTGDQRLPTVLEGSSGFVYYVSVA
GVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAAVARLADGVVVGSALIDRI
AKARDNAQAVKDVLALCGELAEGVRNAR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagacccgcttcgcccagctcaagcaggaaaaccgcgccgccctggtg
accttcgtcaccgccggcgacccggactacgcgtcttccctggaaatcctcaaaggcctg
ccggcggccggagccgacgtgatcgaactgggcatgccgttcaccgatccgatggcggac
ggcccggccatccagttggccaacatccgcgccctcgacggcggccagaccctggccagg
acgttgcagatggtccgcgaattccgcagcggcgacagcgagacacccctggtgctgatg
ggctacttcaacccgatccaccactacggcgtcgagcgcttcatcgccgaggcgaaggag
gtgggggtggacggcctgatcgtggtcgacctgccgccggagcacaacgaagacctctgc
cacccggcccaggccgccggcctcgacttcatccgcctgaccaccccgaccaccggcgac
cagcgcctgccgacggtgctcgaaggcagttccgggtttgtctactacgtgtcggtggcc
ggcgtcaccggcgccaacgcggcgaccctggaacacgtcgaggaagcggtggcgcgcctg
cgccggcataccgacttgccgatcggtatcggcttcggcatccgcagcgccgaacacgcc
gccgcggtcgcgcggttggccgacggcgtggtggtcggctcggcgctgatcgaccggatc
gccaaggcccgcgacaatgcccaggcggtcaaggatgtcctcgccctgtgcggcgagctg
gccgaaggcgtgcgcaacgcacgctga

DBGET integrated database retrieval system