KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_00600
Entry
PA14_00600        CDS       T00401                                 

Definition
(GenBank) putative transcriptional regulator
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB
Motif
Pfam: HTH_3 HTH_31 HTH_19 MerR HTH_38 HTH_37 MerR_1 MarR Sigma70_r4
Other DBs
NCBI-ProteinID: ABJ15006
UniProt: A0A0H2ZJX1
Position
complement(60765..61148)
AA seq 127 aa
MSFAQNLLRLRQQNALTQRQMAERLGVTVSQLRHFETKGGHPSLVVLQTIAGRFAVPLDW
LVCERSERQALPEDLRLQFEAIGRLRLDERRAIRALLDDLIRQYMAKRNAAAKPLPAACA
EATETSP
NT seq 384 nt   +upstreamnt  +downstreamnt
atgagcttcgcgcagaatctcctacgcctacgccagcagaacgccctgacccaacggcag
atggccgagcgactgggcgtcaccgtgagccagttgcggcacttcgaaaccaagggcggg
cacccgtcgctggtggtgctgcaaaccatcgccggacgtttcgcggtgcccctcgactgg
ctggtctgcgagcgcagcgagcggcaggcgctaccggaagacctgcgcctgcagttcgag
gccatcggccgcctgcggctggacgagcggcgcgccatccgggcgttgctcgacgacctg
atccgccagtacatggccaagcgcaacgcagcggccaagcccctcccggcggcttgcgcc
gaggccacggagacgtccccgtag

DBGET integrated database retrieval system