KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_00900
Entry
PA14_00900        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11890  type VI secretion system protein ImpM
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA14_00900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_00900
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PA14_00900
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: ABJ15032
UniProt: A0A0H2ZK01
Structure
PDB: 
2QNU

Position
complement(88489..89169)
AA seq 226 aa
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRF
AIAPGLLGGEAVAGVVMPSIDRVGRYFPLTVACLLPANADLGGLVGGDDGWFEQVESLLL
STLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAVTPAQRLAALAQHACDGA
SHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFPGIPG
NT seq 681 nt   +upstreamnt  +downstreamnt
ttgaacagcgtcggtttctacggcaagctggccggccgcggcgatttcgtcagccgcggc
ctgccgaacaccttcgtcgaaccctgggacgcctggctggccagcggcatgcgcgccagc
caggacgaactcggcgcggcctggctcgacgcctacctgaccagcccgctgtggcgcttc
gccatcgcccccggcctgctcggcggcgaagcggtggccggggtggtgatgccgagcatc
gaccgggtcggtcgctatttcccgctgaccgtcgcctgcctgctgccggcgaacgccgac
ctcggcgggctggtcggcggcgacgacggctggttcgagcaggtcgagagcctgctgctc
tccaccctcgaaccggaggccgaggtcgaggccttcgagcaggcggtggcgcagctcccg
gcccctccctgcggaccgcgcatcgaacaatcgctgatcagcggcaacctgctgcgcagc
gaagcggtgaccccggcgcagcgcctcgccgcgctggcccagcatgcctgcgacggcgcc
agccactggtggggacgcggctcggcacggatctccgccggcctgatgcgctaccagggc
ctgccgccggcgccggcgttcggacgattcctcaccggagagggcgaggtgatcccgctc
tttcccggcatacccggttaa

DBGET integrated database retrieval system