KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_00925
Entry
PA14_00925        CDS       T00401                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_00925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_00925
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_00925
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: ABJ15641
UniProt: A0A0H2ZKR2
Structure
PDB: 
4B62

Position
complement(92696..94045)
AA seq 449 aa
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSG
RGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVM
LARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLH
LLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTRGEYEHELSPHWRGLSVMR
DRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKRIHAIGEIPVQAIDRPAVQP
RVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIAD
ALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVATNASAEGRARNRRVEITVFAEGAQ
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcctcccatcgacgatcccttcggcaccccggccggcggcggcaacggaagcccgccc
gacgaccgcaccatgatcatgccgcgtcccggcggccgcgccccggaaccggccggcggc
ccccgcggcggcgatccctacacgccgccgccgatggccagcctggcgccgctgagcggc
cgcggcgacggcctcaacccgctggagcaggccgccggcccactgctggcgatgctcacc
cgcctgcgcaacaccatcgcccatccggcgccggccagcctgcgcgcgcaactgctcggc
tacctgcgccagttcgaggagaaggcacgccaggccggcgtggcgccggacgaagtgatg
ctggcgcgctacgtgctctgcaccgccctcgacgaagcggtgctcagcacgccgtggggc
agcaccagcgactggggcaagcagagcctgctgatcaccctgcacaacgaggcctggggc
ggcgagaaggtcttccagttgctcgaacactgcctgcagaacccgcaccagcgcctgcac
ctgctggagctgctgtacctgtgcaccagcctcggcttcgaaggccgctaccgggtcatg
cacgacggccgcagccaactggaggcgctgcgcgagcgcaccgcggcggtgatccgcagc
acccgcggcgagtacgagcacgaactgtcgccgcactggcgcggcctcagcgtgatgcgc
gaccgcctttcgcaatacctgccgccgtgggtcggtatcgccatcggcctggccttgctg
ctggccttgctgttcggcctgcggatgaagctggccgccgacgccgagccggtgttcaag
cgcatccacgccatcggcgagatcccggtgcaggccatcgaccgcccagcggtgcagccg
cgggtgatcgaacggccacgcctggcgcgcttcctcgcagacgacatcaaggcccagcgg
gtggcggtggaggacgccgtcgaccgctcggtggtgaccatccgcggcgacgagctgttc
gccagcgccagcgccagcgtgcgcgacgagttccagccgctgctgctgcgcatcgccgac
gccctgcgcaaggtcaagggccaggtgctggtcaccggccatagcgacaaccggccgatc
gccacgctgcgctacccgtccaactggaaactgtcccaggcccgcgcccaggaggtcgcc
gacctgctcggcgcgaccaccggcgacgccggccgcttcaccgccgaagggcgcagcgac
accgagccggtggcgaccaacgccagcgccgaaggccgcgcacgcaaccgccgggtggaa
atcaccgtattcgcggagggcgcgcaatga

DBGET integrated database retrieval system