KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_01020
Entry
PA14_01020        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA14_01020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_01020
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_01020
SSDB
Motif
Pfam: VipB VipB_2 TssC
Other DBs
NCBI-ProteinID: ABJ15040
UniProt: A0A0H2ZJR5
Structure
PDB: 
5N8N

Position
99431..100927
AA seq 498 aa
MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAVRTLAEHALEQTSLIS
NDAIKSIESIIAALDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLN
ISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLG
EMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTTPEYAGWRSLRESEDSRYI
GLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWANSAYAMAVNINRSFKLYGWC
SRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTD
FAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLE
GLTVSLRLVSKLPSAKEA
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggccgaattgagcaccgagaacctggcccagggccagaccaccaccgagcagaccagc
gagttcgccagcctgctgctgcaggagttcaagcccaagaccgagcgcgcccgcgaagcg
gtggagaccgccgtgcggaccctcgccgagcatgccctggagcagaccagcctgatctcc
aacgacgcgatcaagtcgatcgagtcgatcatcgcggcgcttgacgccaagctcaccgcg
caggtcaacctgatcatgcaccacgccgacttccagcaactggaaagcgcctggcgcggc
ctgcactacctggtcaacaacaccgagaccgacgagcaactgaagatccgtgtgctgaac
atctccaagccggagctgcacaagaccctgaagaaattcaagggcaccacctgggaccag
agcccgatcttcaagaagctctacgaagaggaatacggccagttcggcggcgagccctat
ggctgcctggtcggcgactactacttcgaccagtcgccgccggacgtcgagctgctcggc
gagatggcgaagatctccgccgccatgcatgcgccgttcatctccgccgcctcgccgacg
gtgatgggcatgggttcctggcaggaactgtccaacccgcgcgacctgaccaagatcttc
accaccccggaatacgccggttggcgttcgctgcgcgagtccgaggactcccgctacatc
ggcctgaccatgccgcgcttcctggcgcgcctgccctacggggcgaagaccgatccggtg
gaagagttcgccttcgaggaagaaaccgacggcgccgacagcagcaagtacgcctgggcc
aactcggcctacgcgatggcggtcaacatcaaccgctccttcaagctctacggctggtgc
tcgcggatccgtggcgtcgagtccggcggcgaggtgcagggcctgccggcgcacaccttc
cccaccgacgacggcggcgtggacatgaagtgcccgaccgagatcgccatttccgaccgc
cgcgaggcggagctggcgaagaacggcttcatgccgctgctgcacaagaagaacaccgac
ttcgccgccttcatcggcgcgcagtcgctgcagaaacccgccgagtacgacgatccggac
gccaccgccaacgccaacttggcggcgcgcctgccctacctgttcgccacctgccgcttc
gcccattacctgaagtgcatcgttcgcgacaagatcggttccttcaaggagaaggacgag
atgcagcgctggctgcaggactggatcctcaactacgtcgacggcgacccggcccactcc
accgagaccaccaaggcccagcacccgctggcggcggccgaagtggtggtggaggaagtc
gaaggcaatccgggttactacaactcgaagttcttccttcgcccgcactaccagctcgag
ggactgacggtatcgctacgcctggtatccaagctgccttcggccaaagaggcctga

DBGET integrated database retrieval system