KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_01060
Entry
PA14_01060        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
KEGG Orthology (KO) [BR:pau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_01060
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_01060
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ABJ15043
UniProt: A0A0H2ZK32
Position
102506..103015
AA seq 169 aa
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASVLRDLAWLFNTTSLFDH
GPAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLL
PGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVRVAQGERRRT
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctgaactgaccctccaggagcgcctgcagccgtcgctgctcgaccgcctcaccgac
gacgagccgggcaacctcaaggaagccgcggagcgccgggtgctgaccctgagccagctg
aaggcctcggtgctgcgcgacctggcgtggctgttcaacaccacttcgctgttcgaccac
ggccccgccgcacggatgccggccggcaactcggtgctcaactacgggctgccggcgctg
gccgggcacaccgcgtcgagcgtcgacgtgcatgccatcgaggcgctgctcaccgagacc
atcgccaccttcgagccgcgcatcatccgttcttcgttgcgggtgcgcgcgcaactgctg
cccggcgagatggaccacaacgccctgagcttcgagatcgagggcgatctctgggccgaa
ccggcgccgctgcgcctgctgctgaccaccaacctggacctggagaccggtcacgtgcgc
gtcgcccagggcgagcggaggcgtacatga

DBGET integrated database retrieval system