KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_01110Help
Entry
PA14_01110        CDS       T00401                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_01110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_01110
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V
Motif
Other DBs
NCBI-ProteinID: ABJ15047
UniProt: A0A0H2ZK21
Structure
PDB: 

Position
108629..110560
Genome map
AA seq 643 aa AA seqDB search
MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSL
ELPGGSRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQ
VFRDLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLS
DAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPGSLTLNDYDFQRPGARLEV
RSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQAQHERVRLRGVVRGIGAGHL
FRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCIDASQSFRLLPQTP
VPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGKNWG
SMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPA
NFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELVRIGNNRTRAV
KLNDTLLVGGAKSDSVTGTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNG
NIDTGGRLDLNSGGASEVDAKGKGVQGTIDGQVQAMFPPPAKG
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgacccgcctggtccaggtggattgcccgctggggccggacgtgctgctgttg
cagcgcatggagggacgcgaggaactgggacggctgttcgcctacgagctgcacctggta
tcggaaaatcccaacctgccgctggagcagttgctcggcaagccgatgagcctgtcgctg
gagctgcccggcggcagccggcgcttctttcacggtatcgtcgcgcgctgtagccaggtg
gccgggcacggccagttcgccggctaccaggccaccctgcggccctggccgtggctgctg
acgcgcacctcggactgccgcatcttccagaaccagagcgtgccggagatcatcaagcag
gtgttccgcgacctcggcttttccgatttcgaggatgccctcacgcgcccctaccgcgag
tgggaatactgcgtgcagtaccgcgagaccagcttcgacttcatcagccggctgatggaa
caggagggcatctactactggttccgccatgagcagaagcgccacatcctggtgctctcc
gacgcctacggcgcgcatcgcagcccgggtggctacgccagcgtgccgtactacccgccg
accctcggccatcgcgagcgcgaccacttcttcgactggcagatggcacgcgaggtccag
cccggttcgctgaccctcaacgactacgacttccagcgccccggcgcgcgcctggaggtg
cgttcgaacatcgcccggccgcacgcggcggccgactacccgctgtacgactatcccggc
gaatacgtgcagagccaggacggcgagcagtacgcgcgcaaccgcatcgaggcgatccag
gcgcagcacgagcgcgtgcgcctgcgcggcgtggtgcgtgggatcggtgccgggcacctg
ttccgcctgagcggctatccgcgcgatgaccagaaccgcgagtacctggtggtcggcgcc
gaataccgggtggtccaggaactctacgaaaccggcagcggcggcgccggctcgcagttc
gagagcgagctggactgcatcgacgccagccagtcgttccgcctcctgccgcagaccccg
gtgccggtggtgcgcggtccgcagaccgcggtggtggtggggcccaagggcgaggagatc
tggaccgaccagtacggccgggtcaaggtgcacttccactgggatcgccacgaccagtcg
aacgagaacagctcctgctggattcgcgtgtcccaggcctgggccgggaagaactggggt
tcgatgcagatcccgcggatcggccaggaagtgatcgtcagcttcctcgaaggcgacccg
gaccggccgatcatcaccgggcgggtctacaacgccgagcagacggtgccctacgagctg
ccggcgaacgccacccagagcgggatgaagagccgttcgagcaagggcggcacgccggcc
aacttcaacgagatccgcatggaggacaagaagggcgccgagcagttgtacatccacgcc
gagcgcaaccaggacaacctggtcgagaacgatgcctcgctgtcggtcggccacgaccgc
aacaagagcatcggccacgacgagctggtacgcatcggcaacaaccgcacccgcgcggtg
aagctcaacgacaccctgctggtgggcggggcgaagagcgacagcgtcaccggcacctac
ctgatcgaggccggtgcgcagatccgcctggtctgcggcaagagcgtggtggagttcaac
gccgacggcaccatcaatatctccggcagcgccttcaacctctacgccagcggcaacggc
aacatcgacaccggcggccgcctcgacctcaattccggcggtgccagcgaggtcgacgcc
aagggcaagggcgtgcagggcaccatcgacggccaggtacaggcgatgtttccgccgccg
gcgaagggctga

DBGET integrated database retrieval system