KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_01120Help
Entry
PA14_01120        CDS       T00401                                 

Definition
(GenBank) hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tsi6 ApoM
Motif
Other DBs
NCBI-ProteinID: ABJ15048
UniProt: A0A0H2ZK35
Position
complement(110675..110959)
Genome map
AA seq 94 aa AA seqDB search
MSPVNYVERALALVAERLARHPQCGMLLSVEKQLLYLKAVLLDRSLDRSALHRLSFGGIA
GKEFEETDPELARALKDAFYVGIRTGRGLKVDLP
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccgtgaactatgtcgaacgcgccctggcgctggtcgccgagcggctggcccgg
catccgcaatgcgggatgctgctctccgtggaaaagcagttgctgtacctgaaagccgtg
ctgctcgaccgcagcctggaccgttccgcgttgcaccggctgagcttcggcggcatcgcc
gggaaagagttcgaggagaccgacccggaactcgccagggccctcaaggacgcattctac
gtcggcatacgcactggccgcggcctgaaggtcgacctaccctga

DBGET integrated database retrieval system