KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_02500
Entry
PA14_02500        CDS       T00401                                 

Gene name
exbB1
Definition
(GenBank) transport protein ExbB
  KO
K03561  biopolymer transport protein ExbB
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
KEGG Orthology (KO) [BR:pau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pau02000]
    PA14_02500 (exbB1)
Transporters [BR:pau02000]
 Other transporters
  Pores ion channels [TC:1]
   PA14_02500 (exbB1)
SSDB
Motif
Pfam: MotA_ExbB Chlorosome_CsmC DUF937
Other DBs
NCBI-ProteinID: ABJ15153
UniProt: A0A0H2ZKC1
Position
224960..225679
AA seq 239 aa
MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQDRQFQKQFWSATSLDSA
GEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRLERALRQQIQRERRSLESG
LAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVAGPIGSALIATGVGIAVAV
PAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRVIVHPSAARQAGNPSRNVKEAS
NT seq 720 nt   +upstreamnt  +downstreamnt
atgagtctgttaaccaccccgctcgaatccgtcgaaggcgccgtcatctggctgctggtc
ggcttttccgtggtcacctggggcctggccctggtcaagggcgtgcagttcgcccggcag
aagcgccaggaccgccagttccagaagcagttctggagcgccaccagcctcgactccgct
ggcgagcaggcgcaggacaagcagggcgccggcgcccgcgtggcccaggccggcttcgcc
gcgatccaggtgcaggacaacggccagcccgacctggcccagtcgatcaaccaccaggac
cgtctcgaacgcgccctgcgccagcagatccagcgcgagcggcgttctctggagtcgggc
ctggcggtgctcgcctcgatcggctcgacctcgcccttcatcggtctgttcggcaccgtc
tggggcatcatggaggcgctcaaggggatcagcgcggccggctcggcgagcctggagacc
gtggccgggccgatcggcagcgcgctgatcgccaccggcgtgggaatcgccgtcgcggtg
ccggcggtgctggtctacaactacttcctgcggcgcctgaagctgaccgccgccgacctc
gacgacttcgcccacgacttctacagcctggcgcagaagagcgcgttccgcgtcatcgtc
catccctccgccgcgcgccaggccggcaacccctcgcgcaacgtgaaggaggcgtcctga

DBGET integrated database retrieval system