KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_02550
Entry
PA14_02550        CDS       T00401                                 

Gene name
mdcA
Definition
(GenBank) malonate decarboxylase alpha subunit
  KO
K13929  malonate decarboxylase alpha subunit [EC:2.3.1.187]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
KEGG Orthology (KO) [BR:pau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pau02000]
    PA14_02550 (mdcA)
Enzymes [BR:pau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.187  acetyl-S-ACP:malonate ACP transferase
     PA14_02550 (mdcA)
Transporters [BR:pau02000]
 Other transporters
  Primary active transporters [TC:3]
   PA14_02550 (mdcA)
SSDB
Motif
Pfam: Mal_decarbox_Al
Other DBs
NCBI-ProteinID: ABJ15157
UniProt: A0A0H2ZKD9
Structure
PDB: 
5VIT 5VJ1

Position
227383..229047
AA seq 554 aa
MTTPISPPPQWSRRRQEKQRRLERVRGLADGAVLPRERLVAALEALIAPGDRVVLEGNNQ
KQADFLSRSLARVDPGKLHDLHMIMPSVGRPEHLDLFELGIARKLDFSFSGPQSLRIGQL
LEDGLLEIGAIHTYIELYARLVVDLIPNVALVAGFVADREGNVYTGPSTEDTPALVEPTA
FSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQPFYIEPLFTRDPRHIKPVHVLM
AMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYGESLGLKGKICRHWTLNPHPTLIPA
IESGWVESVHCFGTELGMEGYIAQRPDVFFTGRDGSLRSNRMFCQLAGQYAVDLFIGATL
QVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHSTAAWLDMRGEPEALLERGRKLVVQM
VETFQDGGKPTFVERLDALEVARQTGMPLAPVMIYGDDVTHVLTEEGIAYLYKARSLEER
QAMIAAVAGISPIGLRHDPRETQRMRREGLIALPEDLGIRRTDASRELLAAKSIAELVEW
SGGLYQPPARFRSW
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgacgacaccgatctctcccccgccgcagtggtcgcggcgccgccaggaaaagcagcgg
cgcctcgagcgcgtgcgcggcctggccgacggcgcggtgctgccgcgcgaacgcctggtc
gccgcgctggaggcgctgatcgcgccgggcgatcgggtggtgctggaaggcaacaaccag
aagcaggcggacttcctctcccgttcgctggcgcgggtcgatcccggcaagctgcacgac
ctgcacatgatcatgcccagcgtcggtcgtccggagcatctcgacctgttcgaactgggc
atcgcgcgcaagctcgacttctccttctccggcccgcagagcctgcgcatcggccagttg
ctcgaagacggcctgctggagatcggcgcgatccacacctacatcgagctgtacgcgcgg
ctggtggtcgacctgatccccaacgtcgcactggtcgccggtttcgtcgccgaccgcgaa
ggcaacgtgtacaccgggccgagcaccgaagacaccccggcgctggtggagcccaccgcg
ttcagcgacggcatcgtcatcgtccaggtcaaccgtatcgtcgacgacccgcgcgacctg
ccgcgagtggacatcccggcgtcctgggtggacttcgtggtcgaggccgaccagccgttc
tacatcgagccgctgttcacccgcgacccgcgccacatcaagccggtccacgtgctgatg
gcgatgatggcgatccgcggcatctaccagcggcacaacgtgcagtcgctgaaccacggc
atcggcttcaacaccgcggccatcgagctgatcctgccgacctacggcgagtccctcggc
ctgaagggcaagatctgccggcactggaccctcaacccgcacccgacccttatccccgcc
atcgagagcggctgggtcgagagcgtgcactgcttcggcaccgagctgggcatggagggc
tacatcgcccagcgtcccgacgtgttcttcaccggtcgcgacggctcgctgcgttccaat
cggatgttctgccaactggccgggcagtacgcggtagacctgttcatcggcgccaccctc
caggtcgacggcgacggccattcctccaccgtcacccgcggacgcctggccggcttcggc
ggcgccccgaacatgggccacgacccgcgcggccggcgccactcgacggcggcctggctg
gacatgcggggcgaacccgaggccttgctggagcgcggcaggaagctggtggtgcagatg
gtcgagaccttccaggacggcggcaagccgaccttcgtcgagcgtctcgacgcgctggag
gtggcgcgccagaccggcatgccgctggcgccggtgatgatctatggcgacgacgtcacc
catgtgctcaccgaggaaggcatcgcctacctgtacaaggcgcgctcgctggaggaacgc
caggcgatgatcgccgcggtggcggggatcagtccgatcggcctgcgccacgatccgcgc
gagacccagcggatgcgccgcgaagggctgatcgcgctgcccgaggacctcggcatccgc
cgcaccgacgcctcgcgcgagctgctggcggcgaagagcatcgccgagctggtcgagtgg
tccggcgggctgtaccagccgccggcgcgtttcaggagctggtga

DBGET integrated database retrieval system