KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_05770
Entry
PA14_05770        CDS       T00401                                 

Gene name
dhT
Definition
(GenBank) dihydropyrimidinase
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00240  Pyrimidine metabolism
pau00410  beta-Alanine metabolism
pau00770  Pantothenate and CoA biosynthesis
pau01100  Metabolic pathways
Module
pau_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PA14_05770 (dhT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PA14_05770 (dhT)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PA14_05770 (dhT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pau04147]
    PA14_05770 (dhT)
Enzymes [BR:pau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.2  dihydropyrimidinase
     PA14_05770 (dhT)
Exosome [BR:pau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA14_05770 (dhT)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-ProteinID: ABJ15408
UniProt: A0A0H2ZKY9
Structure
PDB: 
6KLK 5E5C 5YKD 6AJD

Position
complement(509567..511006)
AA seq 479 aa
MSLLIRGATVVTHEESYRADVLCANGLIQAIGENLETPSGCDVLDGGGQYLMPGGIDPHT
HMQLPFMGTVASEDFFSGTAAGLAGGTTSIIDFVIPNPRQSLLEAFHTWRGWAQKSAADY
GFHVAITWWSDEVAREMGELVAQHGVNSFKHFMAYKNAIMAADDTLVASFERCLELGAVP
TVHAENGELVFHLQQKLLAQGLTGPEAHPLSRPPQVEGEAASRAIRIAETLGTPLYLVHI
SSREALDEIAYARAKGQPVYGEVLAGHLLLDDSVYRHPDWATAAGYVMSPPFRPVEHQEA
LWRGLQSGNLHTTATDHCCFCAEQKAMGRDDFSKIPNGTAGIEDRMALLWDAGVNSGRLS
MHEFVALTSTNTAKIFNLFPRKGAIRVGADADLVLWDPQGSRTLSAATHHQRVDFNIFEG
RTVRGIPSHTISQGKLLWAAGDLRAEPGAGRYVERPAYPSVYEVLGRRAERQRPVAVER
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgtccctgttgatccgtggcgccaccgtggttactcacgaagagagttatcgagccgac
gtgctctgtgccaacggcctcatccaggccatcggcgagaacctcgaaaccccctccggc
tgcgacgtcctcgacggcggtggccagtacctgatgccgggcggcatcgacccccatacc
cacatgcagttgcccttcatgggcacggtggccagcgaggacttcttcagcggcaccgcg
gccgggctggccggagggaccacctcgatcatcgacttcgtcatccccaacccgcgacag
tcgctgctggaggccttccacacctggcgcggctgggcgcagaaatccgctgcggactac
ggcttccacgtcgccatcacctggtggagcgacgaggtcgcccgggaaatgggcgagctg
gtggcacagcacggggtgaacagcttcaagcacttcatggcctacaagaacgccatcatg
gccgccgacgataccctggtggccagcttcgagcgctgcctggagctgggcgcggtgccg
acggtgcacgcggagaacggcgaactggtcttccacctgcagcagaaactcctcgcccaa
ggcctcaccggccccgaggcgcatccgctgtcgcgtccgccgcaagtcgagggcgaggcc
gccagccgcgccatccgcatcgccgagacgctgggtacgccgctgtacctggtgcatatt
tccagccgcgaggcgctggacgagatcgcctatgcccgcgccaagggccagccggtctac
ggcgaggtgctggccgggcacctgctgctcgacgacagcgtctaccgccacccggactgg
gccaccgcggccggctacgtgatgagcccgccgttccgtcccgtcgaacaccaggaagcg
ctgtggcgcggcctgcagtccggcaacctgcataccaccgccaccgaccactgctgcttc
tgcgccgagcagaaggccatgggccgcgacgacttcagcaagattcccaatggcacggcc
ggcattgaggaccgcatggcgttactgtgggacgccggggtcaacagcgggcgcctgtcg
atgcacgagttcgtcgcgctgacctccaccaacaccgcgaagatcttcaacctgttcccg
cgcaagggcgcgatccgcgtcggcgcggatgccgacctggtgctctgggacccgcagggc
agccgcaccctctcggccgccacccaccaccagcgggtcgatttcaacatcttcgaaggt
cgcaccgtgcgcggcattcccagccacaccatcagccagggcaagctgctctgggccgcc
ggcgacctgcgcgccgaacccggcgccggacgctacgtggagcgcccggcctacccgtcg
gtgtacgaagtgctcggccgccgcgccgaacgccagcgcccggtcgccgtcgagcgctga

DBGET integrated database retrieval system