KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_06290Help
Entry
PA14_06290        CDS       T00401                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00620  Pyruvate metabolism
pau00630  Glyoxylate and dicarboxylate metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA14_06290 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PA14_06290 (glcB)
Enzymes [BR:pau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PA14_06290 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABJ15447
UniProt: Q02TT1
Structure
PDB: 

Position
complement(554958..557135)
Genome map
AA seq 725 aa AA seqDB search
MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADTFWTGAEAVINDLAPKNKALLAKRDEL
QAKIDGWHQARAGQAHDAAAYKAFLEEIGYLLPEAEDFQAGTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQGDAAKPQAVLLKHNGLHF
EIQIDPSSPVGQTDAAGVKDVLMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVSKGGSTFTRTMNPDRVYTRADGSELTLHGRSLLFVRNVGHLMTNDAILDKDGNEVP
EGIQDGLFTSLIAIHDLNGNTSRKNSRTGSVYIVKPKMHGPEEAAFTNELFGRVEDVLGL
PRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWV
PSPTAATLHALHYHKVDVFARQAELAKRTPASVDDILTIPLAPNTNWTAEEIKNEVDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQLLANWLRHGVISQEQVVESL
KRMAVVVDRQNASDPSYRPMAPNFDDNVAFQAALELVVEGTRQPNGYTEPVLHRRRREFK
AKNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aacaacgaagccatccccggaaccggcgtctctgccgacacgttctggaccggtgcggag
gccgtgatcaacgacctggcgccgaagaataaagccctgctcgccaagcgcgacgaactc
caggccaagatcgacggctggcaccaggctcgcgccggccaggcccacgacgccgctgcc
tacaaggccttcctcgaggaaatcggctacctgctgcccgaggcggaagacttccaggcc
ggcacccagaacgtcgacgacgagatcgcccgcatggccggcccgcagctggtggtgccg
gtgatgaatgcgcgcttcgccctgaacgcctccaacgcccgctggggctcgctgtacgac
gcactctacggcaccgacgtgatcagcgaagaaggcggcgccgagaaaggcaagggctac
aacaaggttcgcggcgacaaggtcatcgccttcgctcgcgccttcctcgacgaggccgcg
ccgctggagtccggctcccatgtcgacgccacttcctacagcgtgaagaacggcgcgctg
gtcgtcgcgctgaagaacggcagcgaaaccggcctgaagaacgctggccagttccttgcc
ttccagggcgacgccgccaagccgcaagcggtactgctcaagcacaacggcctgcacttc
gaaatccagatcgacccgagcagcccggtcggccagaccgatgccgcaggcgtgaaggac
gtgctgatggaagccgccctcaccaccatcatggactgcgaggactcggtcgccgcggtc
gacgccgacgacaaggtagtgatctaccgcaactggctgggcctgatgaaaggcgacctg
gccgaggaagtcagcaagggcggcagcaccttcacccgcaccatgaacccggaccgcgtc
tacaccagggccgacggttccgaactgaccctgcacggccgctcgctgctgttcgtgcgc
aacgtcggccacttgatgaccaacgatgcgatcctcgacaaggacggcaacgaagtgccg
gaaggcatccaggacggtctgttcaccagcctgatcgccattcatgacctgaacggcaac
accagccgcaagaacagccgcaccggcagcgtgtatatcgtcaagccgaagatgcacggt
ccggaagaagccgccttcaccaacgagctgttcggccgcgtcgaggacgtcctcggcctg
ccgcgcaacaccctgaaggtcggcatcatggacgaggagcgccgcaccaccgtgaacctg
aaggcctgcatcaaggcggccaaggatcgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaagccggcgccgtggtgcgcaagggcgcc
atgaagtcggagaagtggatcggcgcctacgagaacaacaacgtcgacgtcggcctggcc
accggcctgcaaggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctgatg
gccgccatgctcgagcagaagatcggccatccgctggccggcgccaacaccgcctgggtc
ccgtcgccgaccgccgcgaccctgcacgccctgcattaccacaaggtcgacgtgttcgcc
cgccaggccgagctggccaagcgcaccccggcctcggtggacgacatcctgaccattccg
ctggcgccgaacaccaactggaccgcggaagagatcaagaacgaggtggacaacaacgcc
cagggcatcctcggctatgtcgtccgctggatcgaccagggcgtcggctgctccaaggtg
ccggacatcaacgacgtcggtctgatggaagaccgcgccaccctgcgcatctccagccag
ctgctggccaactggctgcgtcacggcgtgatcagccaggagcaggtggtcgagagcctc
aagcgcatggccgtggtggtcgaccggcagaacgccagcgacccgtcctaccggccgatg
gcgccgaacttcgacgacaacgtcgcgttccaggccgccctggagctggtggtggaaggc
acccggcagccgaacggctataccgagccggtcctgcatcgccgccgccgtgagttcaag
gcgaagaacgggctgtag

DBGET integrated database retrieval system